SecReT4
Protein ID: 16263165
T4SS name [ID]VirB [196]
Gene symbolvirB8
Locus tagSMa1308
StrainSinorhizobium meliloti 1021
Repliconplasmid pSymA [GenBank: NC_003037] [Browse all T4SS(s) in this replicon]
Location [Strand]714274..714945 [-]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDQ92Z00
KEGG IDsme:SMa1308
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-67, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|16263165|ref|NP_435958.1| VirB8 type IV secretion protein [Sinorhizobium meliloti 1021]
MVSADELKTYFEKARRFDQDRVIQVERSARIAWSVAIVAGILAGASIFAVAALTPLKTIEPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEAEENFRTVALLSTQPEQARFSAIYRGSNPDS
PQNTYGRSATARISIASISLINPNVVSVRYMRTITRGEEVRPTHWVATLTFSYVNSPMSSTDRLVNPLGF
AVSEYRADPEAIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|16262453|ref|NC_003037.1|:c714945-714274 Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence
ATGGTCTCGGCGGACGAACTCAAGACATACTTCGAAAAGGCGCGACGCTTCGATCAGGACCGCGTGATCC
AGGTCGAGCGCTCGGCACGCATCGCCTGGTCTGTTGCGATCGTAGCCGGCATTCTTGCGGGCGCTTCGAT
CTTCGCCGTCGCCGCCCTCACGCCGCTGAAAACGATCGAGCCATTTGTCGTGCGCGTCGACAATTCGACG
GGCATTGTCGATGTCGTGTCAGCGCTGACGTCGACGGCCGGCACTTACGACGAGGCCGTGACCAAATACT
TCGCCGCGAAATACGTGCGTGCGCGGGAAGGCTATGTCTGGAGTGAGGCGGAGGAGAACTTCCGCACCGT
CGCCTTGCTGTCGACGCAGCCGGAGCAAGCTCGTTTTTCGGCCATCTATCGCGGCAGCAATCCAGACTCG
CCGCAGAATACCTACGGGCGCAGCGCCACAGCGCGCATCAGCATCGCGTCGATCTCGCTAATCAATCCGA
ATGTCGTGTCCGTCCGTTACATGCGCACGATTACCCGCGGCGAGGAGGTTCGACCCACCCATTGGGTTGC
GACGCTCACCTTCTCTTATGTGAACTCGCCGATGTCATCGACGGATCGGCTGGTGAATCCTCTTGGTTTT
GCGGTTAGTGAATACCGGGCCGATCCGGAGGCCATCAACTGA
 Primer design