SecReT4
Protein ID: 163844261
T4SS name [ID]VirB [373]
Gene symbol-
Locus tagBSUIS_B0067
StrainBrucella suis ATCC 23445
Repliconchromosome II [GenBank: NC_010167] [Browse all T4SS(s) in this replicon]
Location [Strand]60677..60850 [-]
Producthypothetical protein
Component typeVirB7
UniProt IDA9WX91
KEGG IDbmt:BSUIS_B0067
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|163844261|ref|YP_001621916.1| hypothetical protein BSUIS_B0067 [Brucella suis ATCC 23445]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|163844199|ref|NC_010167.1|:c60850-60677 Brucella suis ATCC 23445 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design