SecReT4
Protein ID: 163855373
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1068
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1134719..1135444 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA9IB99
KEGG IDbpt:Bpet1068
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|163855373|ref|YP_001629671.1| unnamed protein product [Bordetella petrii DSM 12804]
MKPSILLSALVLASVQWPAWAQQPATAPARNAQSQERPLAARAVDDRTASEWGLQPQEWARYRELMDGPL
GIYSPSLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDNKPG
AGTPRGSGRMAVFVKDGCTACGQLVQRLQSSGAEFDLYMVGSRQDDARIRDWAKRAQIDPARVHAGSITL
NHDGGRWLSLGLPGDLPAAVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1134719-1135444 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCCGTCGATCCTCCTTTCTGCACTCGTGTTGGCGTCGGTGCAGTGGCCCGCCTGGGCGCAGCAGC
CCGCCACGGCCCCGGCGCGCAACGCACAGAGCCAGGAGCGCCCGCTGGCCGCCCGCGCGGTGGATGACCG
GACCGCCAGCGAATGGGGTCTGCAACCGCAGGAATGGGCACGCTACCGCGAGCTGATGGACGGGCCGCTG
GGCATCTACTCGCCCAGCCTGGACCCGCTGTCTGCCCTGGGCATCGAGGCGCGCACCGACGAAGAACGGC
GGCGCTACGCGGAGCTGCAGGTGCAGGTCGAAGCGCGCCGCGTCGAGAAGCTGCTCGCCTACCAGCGCGC
CTACGACGAGGCCTGGCAGCGCCTGAACCCTGGCATGCAGCGCGTGAACCTGCCCGACAACAAGCCGGGC
GCTGGCACCCCGCGCGGCAGCGGTCGCATGGCGGTGTTCGTCAAGGACGGCTGCACGGCCTGCGGGCAGC
TCGTGCAGCGCCTGCAATCCTCGGGCGCGGAGTTCGACCTGTACATGGTGGGCAGCCGCCAGGATGACGC
CCGTATCCGCGACTGGGCCAAGCGCGCGCAGATCGACCCGGCGCGCGTGCACGCCGGCAGCATCACGCTC
AACCACGACGGTGGCCGCTGGCTGTCGCTGGGCCTGCCCGGTGATTTGCCCGCCGCCGTGCGCGAGGTGA
ACGGCCAATGGCAGCGTCAGCCGTAG
 Primer design