SecReT4
Protein ID: 163855374
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1069
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1135426..1136031 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA9IBA2
KEGG IDbpt:Bpet1069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 201 a.a.     [Download]
>gi|163855374|ref|YP_001629672.1| unnamed protein product [Bordetella petrii DSM 12804]
MAASAVAAAFVSQFLRTLALAAGLCACAVHAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNRRLV
PWPWSLNVAGQSRRFATRADACSGLQQAMRATPHTRIDAGLGQINLGYHKHRFTSACDLLDPYRNLAVAA
EILKEQHTPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPTAAVLAAHQESSP
 
Nucleotide Sequence: 606 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1135426-1136031 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAGCGTCAGCCGTAGCGGCCGCCTTCGTCTCGCAGTTCTTGCGCACTCTGGCGCTCGCTGCTGGCC
TGTGCGCCTGCGCGGTCCATGCCCAGGAGGTTCCGCCACCGGCCTACCAGCTCGCTGCCCAGCGCGCAGG
CATCCCCTCGACCGTGCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGGCGCAACAGGCGCTTGGTG
CCGTGGCCCTGGTCCCTCAACGTCGCCGGCCAGTCGCGCCGCTTCGCCACGCGCGCCGACGCCTGCTCGG
GCCTGCAACAGGCGATGCGCGCCACACCGCACACGCGCATCGACGCAGGCCTGGGCCAGATCAACCTCGG
CTACCACAAGCACCGCTTCACCAGCGCGTGCGACTTGCTGGACCCGTACCGCAACCTGGCCGTTGCCGCC
GAGATCCTGAAGGAGCAGCACACCCCCGGCGAGGACTGGCTGCTGGCGATCGGCCGCTACCACCGCCCCG
CAGGCGGCGAGCCCGCCGCCCGCTATCGGCGCAGCGTGTCGCGCCACCTCGCCCGCGTGCAGGGCACGCG
CCCAACCGCAGCGGTTCTCGCCGCGCACCAGGAGAGTTCCCCATGA
 Primer design