SecReT4
Protein ID: 163855377
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1072
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1138767..1139516 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA9IBA7
KEGG IDbpt:Bpet1072
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.6e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|163855377|ref|YP_001629675.1| unnamed protein product [Bordetella petrii DSM 12804]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSRTAERARAPSHGQTRNFRYYISQAYVWTES
YLIAAAFTTLTFLVRLLVLVLTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFVYHRAKASLMPLAVLP
WITYLALPISVHPLVILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1138767-1139516 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGGACGCCGCCTCGACTGCGCAGCGGGAGCAGAACCAGCGCCAGGGGCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTGATCGGCTCGCTGCTGTTCTCGATCGTGGTGGAGTGCGTGGG
CATGCACCTGTTCTGGAAGGACCAGGGTTGGCGGCACTCCCAGCAGATGCTGCAGTACGAACTCGGGCAC
CTGTCGAACCACTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGCACGGCGCACGAACTGGTGGATA
CCGGCTACGAATGGGTGTTCGTGCGCTCGGGGTTGCTGGAGCGCATGAGCCGGACCGCCGAGCGTGCCCG
TGCGCCCAGCCATGGGCAGACGCGCAACTTCCGCTACTACATCAGCCAGGCCTATGTCTGGACCGAGAGC
TACCTGATCGCCGCGGCCTTTACGACGCTCACGTTCCTCGTGCGCCTGCTGGTGCTGGTGCTCACGCTGC
CGCTGATCTTCACGGCGGCATTCGTTGGGCTGATCGACGGCCTGGTGCGGCGGGACGTGCGCCGGTTCGG
TGCGGGCCGCGAATCCGGCTTCGTGTACCACCGCGCGAAAGCATCGTTGATGCCGCTGGCCGTGCTGCCC
TGGATCACGTATTTGGCGCTGCCGATTTCGGTACACCCGCTGGTCATCCTGCTGCCGAGCGCCGCCTTGC
TGGGACTGGCCGTCAGCCTGACTGCCGGCAGCTTCAAGAAGTACCTCTAG
 Primer design