SecReT4
Protein ID: 163855378
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1073
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1139615..1139998 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9IBA8
KEGG IDbpt:Bpet1073
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 6.2e-29, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|163855378|ref|YP_001629676.1| unnamed protein product [Bordetella petrii DSM 12804]
MVASIWLRAAHRGVPTFLVTALVLGQSPMALAESPAQRQELVAALRQLDALERTVADSAAHTPITPGERY
HFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELASDYRTERTASPPPKTTAEGKQ
 
Nucleotide Sequence: 384 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1139615-1139998 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGTGGCTTCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCGTGC
TGGGCCAGTCCCCGATGGCGTTGGCCGAATCCCCGGCGCAGCGCCAGGAACTGGTCGCCGCGCTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCGGACAGCGCCGCGCATACCCCCATCACGCCTGGCGAGCGCTAC
CACTTCGACTACCCGAGGCTGTTGGCTGACCTGGCGCGCGTGCGCGCCGGCATCCAGGCCCATCTCACTC
CGTCGCGTGCCCAGCCACGCGACCCCTCCGAACTTGCCAGCGACTACCGCACCGAGCGGACCGCTTCGCC
ACCGCCGAAGACGACTGCGGAGGGCAAGCAATGA
 Primer design