SecReT4
Protein ID: 163855381
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1076
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1140617..1141027 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9IBB5
KEGG IDbpt:Bpet1076
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.4e-49, Aligned region: 10..134
Protein Sequence: 136 a.a.     [Download]
>gi|163855381|ref|YP_001629679.1| unnamed protein product [Bordetella petrii DSM 12804]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIAIAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRYPLMAGWVGGHVLISRSGFWTTRRSASRGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1140617-1141027 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACCGTGACGTTCCTTCCGCATCGGCTCAACCGCCACC
CCGTTGTCGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCTTGTCCGGTGCGGCCGGCCT
GCTGGTCGGCGCACCGCTGTCCTGGGTGTTCCGCACGATCGCCATCGCGCCGACGTTCGTCGTCCTGGGC
GTAGCCCTGGGCGTCTTCATCGGCGGCGGCATCCTGCGCCGCCTCAAGCGCGGGCGCCCCGACACCTGGC
TGTATCGGCAACTGCAATGGCGCATCGCTACGCGCTATCCGTTGATGGCGGGCTGGGTGGGCGGCCACGT
TCTGATCTCGCGCTCAGGCTTCTGGACCACCCGACGGTCTGCATCAAGGGGAGCACGATGA
 Primer design