SecReT4
Protein ID: 163855391
T4SS name [ID]Tfc [733]
Gene symbol-
Locus tagBpet1086
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1150367..1151761 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9IBD7
KEGG IDbpt:Bpet1086
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|163855391|ref|YP_001629689.1| unnamed protein product [Bordetella petrii DSM 12804]
MKRPEPMSLSARACRLLRPTPLAGALALVCSLAWAQVGYQNSGPVIGDDVMYSIGGGSAVSMGRAAGMRS
IGVGVGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMALRDAVGSNDAVSAVEQAETRRGNDGVPWVG
GSNAGGAGQSAIRVVGDVTRAGYNLVNGRGVTDTSSIASASCASLSCQTWTSPQQATEWATRVLGEQVQR
TCDSCTKTETVPGVGLTPLIQEEYEAKLEVLQELVSGTRNTTFENLRDAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGGRP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1150367-1151761 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCGTCCCGAACCGATGAGCCTTTCTGCCAGGGCATGCCGCCTGTTGCGCCCGACACCGCTGGCTG
GCGCGCTCGCCCTGGTCTGCAGCCTGGCATGGGCACAGGTTGGATACCAGAACAGCGGGCCCGTCATCGG
CGATGACGTCATGTACTCGATCGGCGGCGGCAGCGCGGTGTCCATGGGTCGCGCGGCCGGCATGCGCTCC
ATCGGGGTCGGCGTGGGGTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGACCACGCTGCGCA
ATCAGCTCAACGGCATCACGAACGGCTTCCAGCAGATCATGAGCAACGTGATCCAGAGCGCCACCAGCGC
GGTGGCGTCCCTGCCGGCGCTGATCATCCAGCGCGCCGACCCGGGTCTGTACAACCTGTTGACCAACGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCCAAGCTGACGTGCCGCGCGATGGCCGAGAAGATGGCCG
AGACGGCGGGCGGCCAACTTGGCTGGAGCCAGATGGCGGAAGGCATGGCGCTGCGGGATGCGGTGGGAAG
CAACGATGCCGTCTCGGCCGTCGAACAGGCCGAGACGCGCCGGGGCAACGACGGCGTGCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCAGGCCAGTCCGCCATCCGGGTGGTCGGCGACGTCACCCGCGCGGGATACA
ACCTCGTCAACGGTCGCGGCGTGACCGACACATCCTCCATCGCGTCCGCCAGTTGCGCGAGCCTGTCCTG
CCAGACCTGGACGTCGCCGCAGCAGGCGACCGAATGGGCCACACGGGTTCTCGGGGAGCAGGTTCAGCGC
ACGTGCGACTCATGCACCAAGACCGAGACGGTGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAAGAGT
ACGAGGCGAAGCTGGAGGTCCTGCAGGAGCTAGTTTCCGGCACGCGCAATACCACCTTCGAGAACCTGCG
CGACGCTGGCAGCACGTCGCTGCCGATCACGCGCGGTGTCATCGAAGCGCTGCGCGACGAACCGGACCAG
GACCTTCTGGCGCGGCGCCTCGCGTCCGAGGTGGCGCTGTCGTCGGTGCTCGAAAAAGCGCTCCTGCTCC
AGCGTACGCTACTTACGGGCAAGAAGGAGCCCAACGTCGCAGCCAACGAACTCGCGGTCGAGGCCGTGAA
CCACGAGAGCGACACGCTCGACCGGGAGATCCGCAACCTGAAGACGGAGCTGGAGCTTCGGCGCGAGCTG
GCAAACAACTCACCGATGGCCATCATCCAGCGGCACGGCACGCGCGCAGCCGGTTCGCGCGGCATCTACG
AGGGCGATCCGGTACCCGACCGCCTTGACCAGTTGCAGAAGGGCAATCCGGGAGGCCGGCCATGA
 Primer design