SecReT4
Protein ID: 163855651
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1344
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1404231..1404815 [+]
Productlipoprotein
Component typeTfc2
UniProt IDA9IE42
KEGG IDbpt:Bpet1344
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|163855651|ref|YP_001629949.1| unnamed protein product [Bordetella petrii DSM 12804]
MQPFSHFHRHLAGCGLLIAAALMAGCATTTPPPKAAPIAKPATAPAKQKPEFVPVVRYGRYTLVELAPAS
AQQDLLLQVVDVAIPDTRTATVGDALRHVLLRSGYQLCSVGEITALNSLPLPASHYRLGPMLLRDALLTL
AGPAWDLKVDDGARRICFTRAPQPTSALIQSASNSASKAAGHVEKRPLTTEVRP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1404231-1404815 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCAACCATTCAGCCACTTCCATCGCCATCTGGCGGGCTGCGGCCTGCTGATCGCAGCCGCACTGATGG
CCGGCTGCGCCACGACGACACCTCCGCCGAAGGCTGCACCCATCGCGAAGCCGGCGACCGCACCGGCAAA
ACAGAAGCCGGAATTTGTTCCTGTCGTTCGCTATGGCCGCTATACCCTGGTCGAACTGGCACCGGCATCG
GCACAGCAAGACCTGCTGTTGCAGGTGGTTGATGTCGCCATACCCGACACGCGCACCGCGACCGTGGGCG
ATGCGTTGCGGCACGTCCTGCTGCGCTCCGGCTACCAGCTCTGCTCGGTGGGCGAGATCACCGCACTCAA
TTCACTACCGCTGCCGGCATCCCACTATCGGTTGGGGCCGATGCTTCTGCGCGACGCCCTGCTGACGTTG
GCAGGCCCCGCGTGGGATCTGAAAGTCGACGATGGCGCCCGCCGGATCTGCTTCACCCGCGCTCCCCAAC
CAACATCTGCTCTGATCCAATCGGCCTCGAACTCAGCCTCGAAGGCGGCCGGTCATGTTGAAAAACGCCC
GCTCACCACGGAGGTCCGGCCATGA
 Primer design