SecReT4
Protein ID: 163855653
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1346
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1405469..1406209 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA9IE46
KEGG IDbpt:Bpet1346
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|163855653|ref|YP_001629951.1| unnamed protein product [Bordetella petrii DSM 12804]
MNRRIILLALATSLAVGAISAATAQNARTATSPVVPSQEQPAITSNSDEQNARDWGLRPEEWTRYREVMR
GPLGIFSPNLDPLTALGIEARSDDERRRYAELQVQVEARRVEKTLAYQRAYDAAWQRLHPGMQRVNLPGA
NIASGASATSSDARRMAVFVKDECAPCGQLVQQLQASGTEFDLYMVGSRQDDARIRDWAKRARIDPSRVR
NGSITLNHDAGRWLSLGLQGDLPAVVRQIGDQWQRQ
 
Nucleotide Sequence: 741 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1405469-1406209 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAACCGCAGGATCATTTTGCTTGCGTTGGCGACCAGCCTTGCCGTCGGTGCCATCTCCGCGGCAACGG
CGCAGAACGCACGAACAGCCACTTCTCCGGTTGTTCCCAGCCAGGAACAGCCGGCAATCACGTCCAACAG
CGATGAACAGAACGCACGCGACTGGGGACTTCGCCCGGAGGAATGGACGCGCTACCGGGAGGTGATGCGG
GGGCCTCTGGGCATCTTCTCGCCCAATCTCGACCCGTTGACAGCACTTGGTATCGAGGCGCGTTCGGACG
ACGAACGTCGCCGCTACGCAGAATTGCAGGTGCAGGTCGAAGCACGTCGCGTCGAGAAAACACTGGCGTA
CCAGCGCGCCTACGACGCCGCCTGGCAACGCCTGCATCCCGGCATGCAGCGCGTCAATCTGCCGGGAGCC
AACATCGCTTCCGGTGCGAGTGCCACATCAAGCGATGCGCGCCGTATGGCCGTATTCGTCAAGGACGAAT
GCGCCCCGTGCGGTCAGCTCGTCCAGCAATTGCAAGCTTCGGGAACCGAATTCGATCTCTACATGGTCGG
AAGCCGCCAGGATGATGCCCGCATCCGCGATTGGGCGAAGCGGGCGCGGATCGACCCCTCCCGTGTTCGC
AATGGCTCCATCACCCTCAACCATGACGCAGGCCGCTGGTTGTCACTGGGTCTGCAGGGAGATCTGCCAG
CCGTCGTGCGGCAGATCGGCGATCAATGGCAACGGCAGTGA
 Primer design