SecReT4
Protein ID: 163855654
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1347
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1406194..1406778 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA9IE47
KEGG IDbpt:Bpet1347
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|163855654|ref|YP_001629952.1| unnamed protein product [Bordetella petrii DSM 12804]
MATAVNRYARLLALLASLMAGTAQAKAQEIPPPAYQLAAQRADIPSPVLYAVALQESGLQRGGRLIPWPW
TLNVAGVARRFSSHAEACEGLRKALREVPPTRIDAGLAQINLGYQKHRYSRPCDLLDPYRNLAIAAEILR
EQHTPGEDWLVAIGRYHRPAGGAPAARYRRSVSQHLARVVGPSRADASTRRNTP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1406194-1406778 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAACGGCAGTGAACCGCTACGCGCGCCTGCTCGCGCTGCTGGCCAGCTTGATGGCCGGAACCGCCC
AGGCTAAGGCCCAGGAGATTCCGCCACCAGCCTACCAGCTCGCAGCGCAGCGCGCCGATATTCCGTCCCC
GGTTCTGTATGCAGTGGCCTTACAGGAAAGCGGCCTGCAGCGTGGCGGCCGGCTGATTCCCTGGCCCTGG
ACTCTGAACGTGGCTGGCGTGGCCCGCCGCTTCAGCAGCCACGCCGAGGCCTGCGAAGGGCTGCGCAAGG
CGCTGCGCGAAGTTCCACCAACACGTATCGATGCTGGCCTGGCTCAAATCAACCTGGGCTACCAGAAGCA
CCGCTACAGCCGCCCCTGCGATCTGCTCGACCCATACCGCAACCTCGCCATCGCGGCCGAAATCCTGCGT
GAACAACACACGCCCGGCGAGGACTGGTTGGTCGCCATCGGCCGTTATCACCGCCCAGCCGGCGGCGCAC
CCGCTGCGCGCTACCGGCGCAGCGTCAGCCAGCACCTGGCGCGCGTGGTCGGTCCTTCCCGTGCTGACGC
TTCCACAAGGAGGAATACACCATGA
 Primer design