SecReT4
Protein ID: 163855655
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1348
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1406775..1407326 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA9IE49
KEGG IDbpt:Bpet1348
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.6e-48, Aligned region: 35..182
Protein Sequence: 183 a.a.     [Download]
>gi|163855655|ref|YP_001629953.1| unnamed protein product [Bordetella petrii DSM 12804]
MKPAFVGAVRPILCALLCAAGLPALAAGQPPLVVVEDHGGTSALPYYQALDLPPRRDQPGPPRISVPPSG
GKTFGEADMLPVRSERLSPGDEPRRVIQAPGLTPVFLIGDDERSRAWLLERKAALTEISAIGLVVNVGSA
EALAGLRKLAPELTLSPVSGDDLAQRLGLRHYPVLITASGIEQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1406775-1407326 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCCTGCCTTCGTAGGCGCCGTGAGGCCGATTCTTTGCGCTCTGTTGTGCGCCGCTGGTCTGCCAG
CCCTGGCGGCGGGCCAGCCGCCTCTCGTCGTGGTCGAGGACCATGGAGGCACGTCCGCTCTGCCTTACTA
CCAGGCGCTGGACCTGCCGCCACGCAGGGATCAACCGGGTCCGCCACGGATCTCCGTACCGCCGTCCGGA
GGCAAGACCTTCGGCGAAGCCGACATGCTGCCCGTGCGCTCGGAGCGGTTGTCGCCCGGCGATGAGCCTC
GCCGGGTGATCCAGGCTCCGGGCCTGACGCCAGTCTTCCTCATCGGCGATGACGAACGCTCACGCGCCTG
GCTGCTTGAGCGCAAGGCGGCGTTGACCGAAATCAGCGCCATCGGTCTCGTGGTCAATGTCGGATCGGCA
GAGGCACTGGCGGGACTGCGCAAGCTGGCGCCCGAGCTCACCTTGTCGCCCGTATCGGGTGACGACCTCG
CTCAGCGGCTCGGACTGCGACACTACCCGGTCCTTATCACCGCCAGCGGCATCGAGCAGTGA
 Primer design