SecReT4
Protein ID: 163855661
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1354
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1412789..1413145 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9IE59
KEGG IDbpt:Bpet1354
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2e-31, Aligned region: 30..108
Protein Sequence: 118 a.a.     [Download]
>gi|163855661|ref|YP_001629959.1| unnamed protein product [Bordetella petrii DSM 12804]
MARSYRLALARRSALAALLLAGLSTALPATAADDSNEKEHLAAVVRQLDLLDRLAKQSAATASQERARYH
FDYTRLAADLQRMRAGINDYLTPQRAQPRDPAALQGDYRQDSEQEPKK
 
Nucleotide Sequence: 357 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1412789-1413145 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCACGGTCCTACCGCTTGGCACTTGCAAGGCGCAGCGCACTCGCGGCGCTGCTGCTTGCCGGCCTGT
CGACGGCTCTGCCGGCGACCGCGGCCGACGACAGCAATGAGAAGGAACATCTGGCGGCAGTCGTTCGCCA
GCTGGACCTGCTCGATCGCCTCGCGAAACAGTCCGCGGCGACCGCATCGCAGGAGCGCGCCCGCTATCAC
TTCGACTACACGCGCCTTGCCGCTGACCTGCAGCGCATGCGGGCCGGCATCAACGACTACCTGACGCCGC
AGCGCGCCCAGCCGCGCGACCCCGCGGCGTTGCAGGGCGACTACCGACAGGACTCCGAACAGGAGCCGAA
GAAATGA
 Primer design