SecReT4
Protein ID: 163855664
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1357
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1413767..1414168 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9IE65
KEGG IDbpt:Bpet1357
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.2e-48, Aligned region: 10..130
Protein Sequence: 133 a.a.     [Download]
>gi|163855664|ref|YP_001629962.1| unnamed protein product [Bordetella petrii DSM 12804]
MPEHQDVRPDGTVAFLPHRLNRHPVVVRGLTADELWVCAGLSGAAGLSVGIPLAIVFSMIAIAPTAIVLG
IAAGVFAGGGMLRRQKRGRPDTWLYRQIQWWIARRHPGLAQFIGGRDLVTRSGYWTTRRRTAS
 
Nucleotide Sequence: 402 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1413767-1414168 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCCTGAGCATCAGGACGTCCGGCCTGACGGAACGGTAGCGTTCCTGCCGCATCGCCTCAATCGCCATC
CCGTGGTCGTGCGCGGCCTCACGGCGGATGAGTTGTGGGTGTGCGCAGGCCTGTCGGGCGCGGCCGGCCT
GTCGGTGGGCATTCCGCTGGCGATTGTCTTCTCGATGATCGCCATCGCGCCCACCGCCATCGTGCTCGGC
ATTGCCGCCGGCGTCTTCGCCGGCGGCGGCATGCTGCGCCGCCAGAAACGCGGCAGGCCCGACACCTGGC
TGTACCGGCAGATCCAGTGGTGGATCGCGCGGCGGCATCCTGGCCTGGCCCAATTCATCGGCGGCCGCGA
TCTGGTGACCCGTTCGGGCTACTGGACCACCAGACGGAGGACCGCCTCGTGA
 Primer design