SecReT4
Protein ID: 163855665
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1358
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1414165..1414857 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA9IE66
KEGG IDbpt:Bpet1358
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 5.7e-90, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|163855665|ref|YP_001629963.1| unnamed protein product [Bordetella petrii DSM 12804]
MSRFKNEITHLQAHIKTLRLGAGALLLVALVMGIGWWNAPRDLTIHVPPDLRSGSTRKWWEVPPESVYSF
SFYIWQQLQRWPVNGDEDYARNIHVLSPYFTPSCQSFLRHDYDYRRTAGELRQRVRGIYEIPGRGYGEDP
TLRVKAVSDRDWIVTLDVTADEYYGSEQVKRALVRYPLKVVRSDVDPERNPFGLAIDCYSGAPQRITTPD
PVTPTGTTSGGLGGALGETP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1414165-1414857 Bordetella petrii DSM 12804 chromosome, complete genome
GTGAGCCGGTTCAAGAATGAGATCACCCACCTGCAGGCGCACATCAAGACCCTGCGCCTCGGCGCGGGCG
CGTTGCTCCTGGTGGCCCTGGTGATGGGGATCGGCTGGTGGAACGCGCCACGCGACCTGACCATCCACGT
GCCGCCGGACCTGCGCTCGGGCAGCACCCGGAAATGGTGGGAGGTGCCGCCAGAGTCGGTTTATTCCTTC
TCGTTTTATATCTGGCAGCAACTCCAGCGCTGGCCCGTCAACGGCGATGAAGACTACGCCCGCAACATCC
ACGTGCTGTCGCCGTACTTCACGCCATCCTGCCAGAGCTTCCTGCGCCACGACTACGACTACCGCCGCAC
GGCCGGCGAACTGCGTCAGCGGGTACGCGGGATCTACGAGATACCCGGCCGAGGCTACGGCGAAGACCCC
ACGCTGCGGGTAAAGGCGGTCTCAGACCGCGACTGGATCGTCACGCTCGATGTCACGGCGGACGAATACT
ACGGCTCCGAACAGGTCAAGCGTGCGTTGGTGCGCTACCCCCTCAAGGTCGTGCGCTCGGACGTCGATCC
GGAACGCAACCCATTCGGCCTGGCCATCGACTGCTACAGCGGTGCGCCGCAGCGCATCACTACCCCCGAC
CCCGTGACACCGACCGGTACGACATCCGGCGGGCTCGGCGGCGCTTTGGGAGAGACGCCATGA
 Primer design