SecReT4
Protein ID: 163855666
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1359
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1414854..1415762 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA9IE68
KEGG IDbpt:Bpet1359
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 9.2e-120, Aligned region: 7..287
Protein Sequence: 302 a.a.     [Download]
>gi|163855666|ref|YP_001629964.1| unnamed protein product [Bordetella petrii DSM 12804]
MKHVLYALGLLVTTSLPTTVQALEILRWERLPLAVSLHVDQERVVFIDRNVRVGVPASLAGRLRVQSAGG
AIYLRASEPIEPTRLQLQDADSGALILLDIAAEPAPAGQAPLEPVRIVEAEGAPTRYGDLAAAAKSDDNG
TQEAVSRTARETPVPVVLTRYAAQNLYAPLRTVEPVSGITRVNLKRNLPLDTLLPTLPVRARALAAWRLD
GLWVTAVRLSNISKRWLSLDPRDLQGDFMTGAFQHNTLGPAGTPDDTSVVYLVTKGHGLGESLLPTISPV
NAALNLPEPKTPARKDGGRHER
 
Nucleotide Sequence: 909 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1414854-1415762 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAACATGTCCTTTATGCCCTTGGACTGCTGGTGACCACGAGTTTGCCGACCACGGTCCAGGCGCTGG
AAATCCTGCGCTGGGAGCGGCTGCCGCTGGCGGTGTCCCTGCATGTGGACCAGGAGCGCGTCGTCTTCAT
CGACCGCAATGTCCGCGTCGGCGTCCCCGCATCGCTGGCCGGCCGCCTGCGTGTCCAGAGCGCCGGCGGC
GCGATCTACCTGCGGGCCAGCGAGCCGATCGAGCCCACCCGGCTGCAATTGCAGGACGCTGACAGCGGCG
CCTTGATCCTGCTGGACATTGCCGCCGAACCAGCACCGGCCGGCCAGGCGCCGCTGGAGCCGGTGCGCAT
CGTCGAGGCCGAAGGCGCTCCGACCCGTTACGGTGACCTGGCAGCGGCGGCTAAGAGCGACGACAACGGC
ACGCAGGAAGCGGTCTCCCGCACGGCTCGCGAGACGCCCGTGCCGGTGGTGCTGACGCGCTATGCGGCCC
AGAACCTTTATGCGCCGCTGCGTACCGTCGAGCCGGTATCCGGCATCACGCGCGTCAATCTGAAACGCAA
CTTGCCACTGGACACCTTGTTGCCGACCCTGCCGGTGCGGGCGCGCGCGCTCGCGGCCTGGCGGCTCGAT
GGCTTGTGGGTGACGGCGGTACGGCTGAGCAACATCTCGAAGCGCTGGCTCTCCCTCGACCCTCGCGACC
TGCAAGGCGACTTCATGACCGGGGCCTTCCAGCACAACACGCTGGGTCCGGCCGGCACGCCCGATGATAC
CTCGGTCGTCTATCTGGTGACGAAGGGGCACGGGCTGGGTGAATCGCTGCTGCCGACGATCAGCCCGGTC
AATGCCGCACTGAACCTGCCGGAACCCAAAACACCGGCTCGCAAGGATGGAGGCCGTCATGAAAGGTAA
 Primer design