SecReT4
Protein ID: 163855667
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1360
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1415752..1417200 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDA9IE70
KEGG IDbpt:Bpet1360
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 482 a.a.     [Download]
>gi|163855667|ref|YP_001629965.1| unnamed protein product [Bordetella petrii DSM 12804]
MKGNGLLKWLMIPMALLLVFVGVKLFSGGGGSQPGRDGGTQLTPEEARALGIEGDTPRDTVATLVGQVRQ
LRTELQTALTDNKTQKAENERLRQREGAIDRRIQSALETERNQLKNDREQVASERQQTQGLLQDLQRQFE
NLSGKNGHADLPVGLGLEPGDGAGLGTDGVRWIEPEDARSDGKSRSPGTTGSFTFPNSFGPAQKTLDTTR
ETVADAGAKAAGISTARPVYTVPTNATLMGSISMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIP
DVAGAVVSGTASGDWTLSCVRGQIRSVTFVFHDGTIRTVPEDGERGGNRQQNGNGNGNGSSTQDGLGWIS
DPYGIPCVSGERRSNAQQYLGTQALITAAGAGAASLIKSDNGSVAVVANNNGSLGTVGISGNEAMGRILA
GGVQDMSQWVNKLYGQAFAAVYVKPGARVAVHLEQPLTIDYDPKGRKVDHRLGGASDAQDLD
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1415752-1417200 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAAGGTAATGGCCTGCTCAAGTGGTTGATGATCCCGATGGCGCTGCTGCTGGTGTTCGTCGGCGTGA
AGCTGTTTTCCGGCGGCGGGGGAAGCCAGCCTGGTCGGGACGGCGGAACCCAGCTCACACCGGAAGAAGC
CAGGGCGCTTGGCATCGAAGGCGACACGCCACGGGATACGGTGGCCACCCTGGTCGGCCAGGTCCGGCAG
CTGCGCACCGAACTGCAGACGGCGCTGACCGACAACAAGACCCAGAAGGCGGAGAACGAACGCCTGCGTC
AGCGCGAGGGTGCCATCGATCGCCGTATCCAGAGCGCCCTGGAGACCGAGCGCAACCAGCTGAAAAATGA
CCGTGAACAGGTCGCCAGCGAACGCCAGCAAACCCAGGGCCTGCTGCAGGACCTGCAGCGCCAGTTCGAA
AACCTGAGCGGCAAGAACGGCCATGCCGATCTGCCGGTCGGGCTTGGCCTTGAACCCGGCGATGGCGCCG
GGCTCGGAACCGATGGCGTGCGATGGATCGAGCCGGAAGATGCGCGCAGCGACGGCAAGAGCCGCAGCCC
CGGCACCACCGGAAGCTTCACATTCCCGAACAGCTTCGGCCCGGCACAGAAGACGTTGGACACCACCCGG
GAGACGGTCGCGGATGCCGGAGCCAAGGCGGCCGGCATCTCCACCGCCAGGCCGGTCTATACCGTACCGA
CCAACGCCACGCTGATGGGTTCGATTTCGATGACGGCATTGATCGGGCGCGTCCCGATCGACGGGACCGT
GAACGATCCGTACCCCTTCAAAGTCCTGATCGGCCCGGACAATCTCACCGCGAACGGCATCGACATTCCC
GATGTCGCCGGTGCGGTCGTTAGCGGCACGGCGTCGGGCGACTGGACGCTCTCTTGCGTGCGCGGGCAGA
TCCGCTCGGTCACCTTCGTGTTCCATGACGGCACCATCCGCACGGTGCCGGAGGACGGCGAGCGTGGCGG
CAACCGCCAGCAGAACGGCAACGGCAATGGCAATGGCAGCAGTACGCAGGATGGCCTCGGCTGGATCAGC
GATCCCTATGGCATTCCCTGCGTGAGCGGTGAACGGCGCAGCAACGCCCAGCAATATCTGGGCACCCAGG
CGTTGATCACCGCGGCTGGAGCCGGCGCCGCCTCACTGATCAAGTCCGACAACGGCAGCGTGGCGGTGGT
CGCCAACAACAACGGCTCGCTCGGCACGGTCGGCATTTCCGGCAACGAAGCCATGGGCCGCATCCTGGCC
GGTGGCGTCCAGGACATGTCGCAGTGGGTGAACAAGCTCTATGGCCAGGCGTTCGCAGCCGTCTACGTCA
AGCCCGGCGCCAGGGTCGCGGTTCATCTCGAACAACCCCTCACCATCGATTACGACCCGAAGGGGCGCAA
GGTCGATCATCGTCTCGGAGGTGCTTCTGATGCACAGGATCTGGATTAA
 Primer design