SecReT4
Protein ID: 163855668
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1361
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1417181..1417615 [+]
Productlipoprotein
Component typeTfc15
UniProt IDA9IE71
KEGG IDbpt:Bpet1361
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 144 a.a.     [Download]
>gi|163855668|ref|YP_001629966.1| unnamed protein product [Bordetella petrii DSM 12804]
MHRIWINGMAVLVIAVALGGCSTSKEKLLPHDGQSMLDIWNEETGGSARGGQTARQLLDARQSLRRPLTE
VDVKAAPAVNASYTRTAQNEIYRQFQRLPNPDLVMYVFPHLVGTDPVPVPGYTTVFPLYQRVQYAMPGER
TEDY
 
Nucleotide Sequence: 435 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1417181-1417615 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCACAGGATCTGGATTAACGGCATGGCGGTGCTCGTCATCGCCGTGGCGCTTGGCGGTTGCTCGACCA
GTAAGGAAAAATTGCTGCCTCACGATGGGCAGAGCATGCTGGATATCTGGAACGAGGAAACCGGCGGTAG
CGCCCGCGGCGGCCAGACCGCACGGCAGTTGCTAGACGCAAGACAGTCGCTGCGCCGCCCGCTGACCGAA
GTCGATGTGAAGGCCGCACCTGCGGTCAATGCCAGCTACACCCGCACGGCGCAAAACGAGATCTACCGGC
AGTTCCAGCGCCTGCCGAATCCCGATCTCGTGATGTACGTGTTTCCCCATCTTGTGGGCACCGATCCGGT
GCCCGTCCCCGGCTACACCACCGTCTTCCCGCTGTACCAGCGCGTGCAATACGCCATGCCGGGCGAACGG
ACCGAGGATTACTGA
 Primer design