SecReT4
Protein ID: 163855669
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1362
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1417615..1420494 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDA9IE73
KEGG IDbpt:Bpet1362
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.2e-69, Aligned region: 65..339
AAA_10 [PF12846], Evalue: 6.4e-44, Aligned region: 533..870
Protein Sequence: 959 a.a.     [Download]
>gi|163855669|ref|YP_001629967.1| unnamed protein product [Bordetella petrii DSM 12804]
MGPFFKRRATPPDTDSGSSPEATPDAWERYLAQLQAHGIPEPGKQDTRRRPATLADEQALYEVSPSFADL
LPWVEYLPESRCMLLEDGISVAAFFELMPIGTEGREASWLAQVRDALENALQDSFDELDESPWVIQLYAQ
DDADWNRYLSTLENYLQPRARESAFTKFYLRFFGHHLRAVSRQGGLFEDRTVTRLPWRGQTRRVRLVVYR
RVGNAPARRGQSPEQALNVACERLAGGLANAGVQAHRLDAAAIHAWLLPWFNPGPSLLGPTDEDRERFYR
LASYPEATGEDELELASGTDFAQRLFFGQPRSDVDNGLWFFDGMPHRTIVLDRLRTPPATGHLTGETRKG
GDAINALFDQMPEDTTLCLTLVITPQDILEAHLNHLAKKAVGETLASEQALKDVQQARGLIGSSHKLYRA
SLAFYLRGRDLADLDMRGLQLGNVLLNAGLQPVREEDEVAPLNSYLRWLPCVYDPGKDKRQWYTQLMFAQ
HAANLAPVWGRSQGTGHPGITFFNRGGGTVTFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNILNQVTAI
YRPRMFIVEAGNSFGLFGDFAARLGLTVHRVKLSPGAGVSLAPFADAWRLVDTPSQVQTLDADALDEDSA
EEESTEGDEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILEAAQRCVSEKRTVLTRDVRDA
LRERGRDPTLPESRRTRLLEMSDAMDMFCQGIDGEMFDRAGTPWPEADITIVDLATFAREGYNAQLSIAY
ISLINTVNNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWYWLATQNLDDLPKAAE
PMLNMIEWWVCLSMPPDEVEKIARFRELNPSQKALMLSARKEARKFTEGVILSKSMELLFRAVPPSLYLA
LAMTEPEEKAERYQLMQQFGIGELDAAFKVAEKIDRARGINSLPLDALD
 
Nucleotide Sequence: 2880 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1417615-1420494 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGGACCGTTCTTCAAACGCCGCGCTACACCGCCCGATACTGACAGCGGCTCCTCGCCAGAGGCTACAC
CCGACGCATGGGAGCGCTACCTTGCGCAACTACAGGCCCATGGCATCCCTGAACCAGGCAAACAGGACAC
CAGGCGCAGGCCCGCGACGCTGGCCGACGAGCAGGCGTTGTATGAGGTTTCGCCGTCCTTTGCCGACCTG
CTGCCGTGGGTCGAGTATCTGCCGGAGTCCCGATGCATGCTACTGGAGGACGGCATTTCCGTCGCCGCAT
TCTTCGAGCTGATGCCGATCGGTACGGAAGGCCGGGAAGCATCCTGGCTGGCTCAGGTTCGTGACGCCCT
TGAAAACGCGCTCCAGGACAGTTTCGATGAGCTGGACGAGTCCCCCTGGGTGATCCAGCTGTATGCTCAG
GACGATGCCGACTGGAACCGCTATCTTTCCACCCTTGAAAACTACCTTCAGCCGCGGGCCAGGGAAAGCG
CGTTCACGAAGTTCTACCTCCGCTTCTTTGGCCACCATCTGCGCGCCGTCTCCAGACAGGGAGGGCTGTT
CGAGGACCGCACCGTCACGCGCTTGCCCTGGCGCGGGCAGACGCGGCGTGTTCGACTGGTCGTCTACCGG
CGTGTCGGCAATGCGCCAGCCCGCCGCGGACAATCCCCCGAACAGGCATTGAATGTCGCCTGCGAACGCC
TGGCCGGCGGCCTAGCCAATGCCGGCGTGCAGGCGCACCGCCTCGATGCCGCTGCCATCCATGCCTGGTT
GCTGCCTTGGTTCAATCCTGGACCAAGCTTGCTGGGCCCGACAGACGAAGACCGTGAGCGGTTCTATCGC
CTGGCTTCCTATCCGGAAGCGACCGGAGAAGACGAACTGGAACTTGCCAGCGGCACCGATTTCGCGCAGC
GGCTGTTTTTCGGCCAGCCGAGATCCGATGTCGACAACGGCCTCTGGTTCTTCGACGGCATGCCCCATCG
CACCATCGTGCTTGATCGCTTGCGCACGCCGCCTGCAACCGGCCACCTGACCGGCGAAACCCGCAAAGGC
GGTGACGCCATCAATGCCCTGTTCGACCAGATGCCCGAAGACACGACCCTGTGCCTCACCCTGGTGATCA
CGCCCCAGGACATTCTCGAAGCCCATCTGAACCATCTGGCGAAGAAAGCGGTCGGCGAAACCCTGGCATC
GGAACAGGCGCTGAAGGACGTGCAGCAGGCGCGCGGGCTGATCGGCAGTTCGCACAAACTCTATCGCGCT
TCGCTGGCGTTCTACCTGCGCGGCCGCGATCTCGCCGATCTCGATATGCGTGGCCTCCAACTCGGCAATG
TCCTGCTCAATGCCGGTCTGCAGCCGGTGCGCGAGGAAGACGAAGTAGCACCACTCAACAGCTACCTGCG
CTGGCTTCCCTGCGTCTACGATCCCGGCAAAGACAAACGGCAGTGGTACACCCAGCTGATGTTTGCACAA
CACGCGGCCAATCTGGCGCCGGTCTGGGGCCGCAGCCAGGGGACCGGCCACCCCGGCATCACCTTCTTCA
ACCGCGGCGGTGGTACGGTTACGTTCGACCCGCTTAACCGGCTCGATCGGCAGATGAATGCGCACCTGTT
CCTGTTCGGGCCCACGGGATCGGGCAAGAGCGCGACCCTGAACAACATCCTCAACCAGGTCACAGCGATT
TATCGCCCGCGAATGTTCATCGTGGAAGCAGGCAACAGCTTCGGGTTGTTCGGTGATTTTGCGGCGCGGC
TGGGCCTCACCGTGCATCGCGTCAAGCTCTCACCCGGCGCCGGCGTGAGCCTTGCACCGTTTGCCGATGC
CTGGCGCCTGGTCGATACGCCGAGCCAGGTGCAGACACTCGATGCCGACGCGCTGGACGAGGACAGCGCC
GAAGAGGAATCGACGGAGGGAGACGAACAGCGTGACGTGCTGGGAGAACTGGAAATCACCGCCCGGCTGA
TGATCACTGGCGGCGAGGATAAAGAGGAAGCCCGAATGACAAGGGCCGACCGCAGCCTGATCCGTCAATG
CATCCTTGAGGCCGCACAACGCTGCGTATCGGAGAAGCGCACGGTATTGACCCGCGACGTGCGCGATGCG
CTACGCGAGCGTGGCCGCGATCCCACGTTGCCGGAATCGCGCCGCACGCGCCTGCTGGAAATGTCGGATG
CGATGGACATGTTCTGCCAGGGAATCGACGGTGAAATGTTCGACAGGGCCGGGACCCCCTGGCCGGAGGC
CGATATCACCATCGTTGACCTGGCGACGTTCGCGCGGGAGGGCTACAACGCGCAGCTCTCGATCGCGTAT
ATCAGCCTCATCAACACGGTCAACAACATCGCTGAACGCGATCAGTTCCTCGGTCGCCCCATCATCAATG
TGACCGATGAGGGCCATATCATCACGAAAAACCCGTTGCTTGCGCCCTATGTCGTGAAGATCACGAAGAT
GTGGCGCAAGCTGGGGGCCTGGTACTGGCTCGCCACCCAGAACCTCGACGACCTGCCAAAAGCGGCGGAA
CCCATGCTCAACATGATTGAATGGTGGGTCTGCCTCAGCATGCCGCCCGACGAGGTGGAGAAGATCGCCC
GTTTCCGCGAACTCAATCCGTCACAAAAAGCCCTGATGCTCTCAGCCAGGAAGGAGGCCCGGAAGTTCAC
GGAAGGCGTGATCCTCTCCAAGTCGATGGAACTGCTGTTCCGCGCCGTCCCGCCAAGCCTGTACCTGGCG
CTTGCCATGACCGAGCCGGAAGAGAAGGCTGAGCGCTACCAGCTAATGCAGCAGTTCGGCATCGGCGAAC
TCGACGCTGCCTTCAAGGTCGCGGAAAAGATCGACCGGGCGCGCGGCATCAACTCGTTGCCGCTGGACGC
ACTGGACTGA
 Primer design