SecReT4
Protein ID: 163855681
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1374
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1435548..1435997 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDA9IE94
KEGG IDbpt:Bpet1374
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1e-34, Aligned region: 36..146
Protein Sequence: 149 a.a.     [Download]
>gi|163855681|ref|YP_001629979.1| unnamed protein product [Bordetella petrii DSM 12804]
MLNLFRTQSGPIRFPSVVASSFCVALALASQAASAAEVTVFTDRSVTLKSAENANVVRLDEAQEIEAGLA
ADLPADPHRAQAIVQERLKQGGARLQRDLASAWQGVADAWSLSVSTVPAVVVDRRYVIYGETDVARAVAR
IEAYRRAQP
 
Nucleotide Sequence: 450 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1435548-1435997 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCTCAACCTGTTTCGCACCCAATCCGGGCCTATACGCTTTCCATCGGTAGTCGCCAGCAGCTTCTGCG
TTGCACTAGCTCTGGCCAGCCAGGCGGCCAGCGCCGCCGAGGTGACGGTCTTCACCGACCGATCCGTCAC
GCTGAAATCGGCCGAGAATGCCAATGTCGTCCGCCTCGACGAGGCACAGGAAATCGAGGCCGGCCTCGCG
GCCGATCTGCCCGCTGATCCCCATCGCGCCCAGGCCATCGTCCAGGAACGCCTCAAGCAGGGCGGCGCCC
GGCTGCAACGCGACCTTGCCTCCGCTTGGCAGGGCGTGGCCGATGCCTGGAGCCTTAGCGTTTCCACCGT
TCCCGCTGTTGTGGTCGACAGGCGCTACGTCATCTATGGCGAAACGGACGTAGCCAGGGCGGTTGCCCGC
ATCGAGGCATACCGGAGGGCTCAGCCATGA
 Primer design