SecReT4
Protein ID: 163855682
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1375
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1435994..1436938 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA9IE96
KEGG IDbpt:Bpet1375
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.2e-94, Aligned region: 31..299
Protein Sequence: 314 a.a.     [Download]
>gi|163855682|ref|YP_001629980.1| unnamed protein product [Bordetella petrii DSM 12804]
MKRARRLRAAIAALMLGTASSAFALNTATITTSALSPDCLEYRVVGICYWLFCTTFGCSVRTSVKVRHYV
PDAVVSSYATTGENPWLEVRAMSMPNTTAQAGGDGTTNQDHENNLSKFKNADVIGHPGGAVLGQLASASG
YSCEGAGTAFMPYLLSTLDTVAWRYNVPEAVYPEALIPGIREIGARTSLNLWGAVYPRGGFLHQTDDYKS
GAVVAQRAGDIVTRRGQIHVYQPLLATARDGYWPAGELVEGDASTGKWQELTPTMSSSCAVFPHSNQRVQ
AQQGDYAWALWRPYSCCQRRGQTFLGSVDFGGGS
 
Nucleotide Sequence: 945 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1435994-1436938 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCGCGCCCGTCGCCTCCGCGCCGCAATTGCGGCCCTCATGCTTGGAACCGCATCGTCGGCCTTCG
CGCTCAACACGGCCACGATCACGACTTCGGCCCTGTCTCCGGACTGCCTCGAATACAGGGTCGTCGGGAT
CTGCTACTGGCTGTTCTGCACCACCTTCGGCTGCTCGGTGCGGACATCGGTGAAAGTGCGCCACTACGTG
CCGGACGCCGTGGTATCCAGCTACGCCACTACGGGCGAGAACCCGTGGCTCGAAGTGCGGGCCATGAGCA
TGCCGAACACCACGGCGCAGGCCGGCGGCGATGGCACGACGAACCAGGACCACGAAAACAACCTGTCGAA
GTTCAAGAACGCTGACGTGATCGGCCACCCCGGCGGCGCGGTCCTGGGTCAGCTCGCCAGCGCTTCGGGC
TATTCCTGCGAAGGTGCCGGCACGGCTTTCATGCCATACCTGCTGAGCACGCTCGACACGGTGGCCTGGC
GCTACAACGTGCCGGAGGCCGTCTATCCGGAAGCGCTGATCCCCGGCATCCGCGAGATCGGAGCGAGGAC
CTCACTGAACCTGTGGGGTGCCGTCTATCCACGGGGCGGTTTCCTGCACCAGACCGACGATTACAAGAGC
GGAGCCGTTGTCGCGCAGCGCGCCGGCGATATCGTCACCCGCCGTGGCCAGATCCACGTCTACCAGCCCC
TGCTTGCCACCGCTCGCGACGGCTACTGGCCCGCAGGCGAGCTTGTCGAAGGCGACGCCTCCACGGGCAA
GTGGCAGGAACTCACGCCCACGATGTCCAGTTCGTGCGCCGTCTTCCCGCATTCGAACCAGCGCGTCCAG
GCCCAGCAGGGTGACTATGCCTGGGCGCTCTGGCGGCCCTACAGCTGCTGCCAGCGCCGGGGTCAGACAT
TCCTTGGCAGCGTCGACTTCGGTGGAGGCTCCTGA
 Primer design