SecReT4
Protein ID: 163855683
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1376
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1436940..1438346 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9IE97
KEGG IDbpt:Bpet1376
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|163855683|ref|YP_001629981.1| unnamed protein product [Bordetella petrii DSM 12804]
MTSRSPAPAIHKHLRRSLLVFALTVACSGAVAQTSVNEYGLQHRGSVIGDDVLYSIGGGRAVSMTGAANM
RSIGVGVGWNSNLICGDMSLTTTLQNQLNGITNGFQTIMSNVIQNATSAVASLPALIIQRADPGLYNLLT
NGVLQARLDFDRSKLTCRAIANRMADTAGGQLGWDQLAEGMALKKAVASTDAVSAIEEAESSKGNEGVPW
VGGDNAGGSGQAPIRVVADVTRAGYNLVNGRSVDDTSSIDSGSCGDRLTCQTWSSPQAAVTWATRVLGEQ
EQRTCESCTKTQTTPGVGLTPLIQEEYETKLESLQELISGSQSMSFDNLQKASSTSLPITRGVIEALRDE
PDQDILARRLASEVALASVLEKALLLQRTLLTGRMEPNVAANEMAQEAVTQESDILDREINNLKTELELR
RELANNSPMQIIQRHSTRAAGSRGVYQGDPIPNRLDELQRSQPGGSNP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1436940-1438346 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACTTCACGTTCTCCTGCTCCAGCCATTCACAAACATCTGCGCCGGAGCCTGCTCGTTTTCGCCCTGA
CGGTGGCATGCTCTGGCGCCGTCGCCCAGACGAGCGTCAACGAATACGGCCTGCAACATCGTGGCAGCGT
GATTGGCGACGATGTGCTGTACAGCATCGGCGGCGGCCGGGCCGTATCGATGACGGGCGCGGCCAACATG
CGCTCGATCGGTGTTGGCGTTGGCTGGAACAGTAACCTCATTTGCGGCGACATGAGCCTCACCACCACGC
TGCAGAACCAGTTGAATGGCATCACCAACGGGTTCCAGACCATCATGTCGAACGTGATCCAGAACGCCAC
CAGCGCGGTGGCTTCTCTGCCCGCGCTGATCATCCAGCGCGCCGATCCTGGTCTCTATAACCTGCTCACC
AACGGTGTCCTGCAAGCCAGGCTCGATTTCGACCGCTCAAAACTCACCTGCCGGGCGATCGCGAACAGGA
TGGCCGACACGGCTGGCGGCCAGCTCGGCTGGGATCAGCTCGCGGAAGGCATGGCGCTCAAGAAGGCCGT
CGCCAGTACCGACGCGGTTTCCGCGATCGAGGAGGCGGAGAGCAGCAAGGGCAATGAGGGAGTGCCATGG
GTCGGAGGCGACAATGCCGGCGGTTCGGGCCAGGCGCCTATCCGGGTGGTCGCTGACGTGACGCGCGCCG
GCTACAACCTCGTCAACGGCCGCAGCGTCGATGACACCTCGTCCATCGATTCCGGCAGTTGCGGCGACCG
GCTGACGTGCCAGACCTGGAGTTCTCCGCAGGCTGCTGTCACCTGGGCCACTCGTGTCCTGGGCGAGCAG
GAACAGCGCACCTGCGAAAGCTGCACCAAGACGCAGACCACGCCCGGCGTCGGGCTGACCCCGCTCATCC
AGGAAGAATACGAGACCAAGCTGGAAAGCCTGCAGGAACTGATCTCGGGCAGCCAGTCGATGAGCTTCGA
CAATTTGCAGAAAGCAAGCAGCACGTCCCTGCCGATCACACGCGGCGTGATCGAAGCGCTTCGGGATGAG
CCGGATCAGGACATCCTCGCAAGGCGTCTCGCTTCCGAGGTTGCGCTCGCCAGCGTGCTGGAAAAAGCCT
TGCTGCTTCAGCGCACGTTGCTGACCGGACGGATGGAGCCGAATGTGGCAGCGAACGAAATGGCTCAGGA
GGCGGTCACTCAGGAGAGCGACATTCTCGACCGCGAGATCAACAACCTCAAGACCGAGCTCGAACTGCGC
CGTGAGTTGGCCAACAACTCCCCAATGCAGATCATCCAGCGCCACAGCACCCGGGCCGCAGGTTCGCGCG
GCGTCTACCAGGGCGATCCCATCCCCAATCGCCTCGACGAGTTGCAGCGTTCGCAACCGGGAGGAAGCAA
TCCATGA
 Primer design