SecReT4
Protein ID: 163855685
T4SS name [ID]Tfc [734]
Gene symbol-
Locus tagBpet1378
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1438707..1440224 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA9IEA1
KEGG IDbpt:Bpet1378
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.9e-125, Aligned region: 10..491
Protein Sequence: 505 a.a.     [Download]
>gi|163855685|ref|YP_001629983.1| unnamed protein product [Bordetella petrii DSM 12804]
MTLYTSDYLEYYLTLVGWIVHNGIWSVLVASGLFALPFLAIVIQEWLKARAEGADEGNKGVLSSMRIENR
VFVAIVVIMFAGIPFIDVDLNTISFDQSRSSQCQVNVPAPSDTGWGQSFTTLNNQSAKVPVWWFFMHSIS
KAVTSAAVAAIPCGTDLRQMRMDIDNTRIDDPLLAQEVTDFALNCYGPARAKLFMNRPNLSEEQMADVSW
IGSNYFVDTPGYYDTYRSSTPREPWPYDDSRDAGLTEVPSGAGYPNCREWWSDGSTGLRARLLAQVDPNL
LSRMANWAGFISRTELDDSVIRAIAAPRQQKLNQGAVYTDYGGQIDKTLPNVVTRAAGDVGMAVGAIGLF
PAMDVMRQALPMSLSLLKMALVICIPLVLVIGTYDLKTLVTVSVVQFALFFVDFWFQLARWVDSTILDAL
YGWGWGYNRPMTNFDPVMGLNNAFGDLLLNFVMATMFLVLPGFWLAALTWVGVRAAGIVSAFSNSTKDAA
SAGGKGPAIISSKLK
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1438707-1440224 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGCTCTACACGTCCGACTACCTGGAGTATTACCTCACCCTCGTCGGGTGGATCGTTCACAACGGCA
TCTGGTCAGTTCTGGTCGCCAGCGGCCTGTTCGCGCTTCCGTTTCTCGCCATCGTGATTCAGGAATGGCT
GAAAGCGCGCGCGGAAGGGGCCGACGAAGGCAACAAGGGCGTGCTCTCCTCGATGCGAATAGAAAACAGG
GTGTTCGTCGCCATCGTCGTGATCATGTTCGCCGGCATTCCTTTCATCGATGTGGATCTCAACACCATCA
GCTTCGACCAGTCCCGCTCCAGTCAGTGCCAGGTGAACGTTCCTGCGCCCAGCGATACCGGCTGGGGCCA
GTCATTCACCACGCTCAACAACCAGTCCGCCAAGGTGCCGGTCTGGTGGTTCTTCATGCACTCGATCTCC
AAGGCGGTCACCAGCGCCGCCGTCGCGGCGATCCCGTGCGGAACCGACCTGCGGCAGATGAGGATGGACA
TCGACAACACCCGTATCGACGATCCCCTTCTGGCCCAGGAGGTGACGGATTTCGCGCTCAACTGCTACGG
CCCGGCGCGGGCCAAGTTGTTCATGAACCGGCCGAACCTCAGCGAGGAGCAGATGGCGGACGTCAGTTGG
ATCGGCTCCAACTACTTCGTCGACACGCCTGGATACTACGACACCTATCGTTCCAGCACGCCTCGCGAAC
CCTGGCCCTACGATGACAGTCGCGACGCCGGATTGACCGAGGTGCCGAGCGGCGCCGGATACCCGAACTG
CCGGGAATGGTGGTCGGATGGCTCAACCGGACTGCGTGCGCGCTTGCTGGCTCAGGTCGATCCCAATCTG
CTTTCGCGCATGGCGAACTGGGCTGGCTTCATCTCCAGGACCGAACTGGACGATTCCGTGATCCGCGCCA
TCGCCGCCCCGCGGCAGCAGAAGCTGAATCAGGGCGCCGTCTACACCGATTACGGTGGACAGATCGACAA
GACCTTGCCGAATGTCGTTACGCGGGCTGCAGGAGACGTGGGAATGGCGGTCGGCGCCATCGGGCTTTTT
CCTGCGATGGATGTCATGCGCCAGGCGTTGCCCATGTCGTTGTCGCTGCTCAAGATGGCGCTGGTGATCT
GCATTCCGCTCGTGCTGGTGATCGGCACCTACGACCTGAAAACCCTCGTCACGGTGAGCGTGGTGCAGTT
TGCACTGTTCTTCGTCGACTTCTGGTTCCAGCTGGCGCGCTGGGTCGATTCCACGATCCTCGACGCGCTC
TATGGCTGGGGATGGGGCTACAACCGTCCGATGACCAACTTCGATCCGGTGATGGGGCTGAACAATGCGT
TCGGGGATCTGCTGTTGAACTTCGTCATGGCGACGATGTTCCTGGTGTTGCCTGGGTTCTGGCTCGCCGC
GTTGACATGGGTTGGCGTACGCGCGGCTGGAATAGTCTCCGCCTTCTCGAACAGCACCAAAGACGCGGCA
TCGGCTGGAGGGAAAGGACCTGCCATCATCTCAAGCAAGCTCAAGTAG
 Primer design