SecReT4
Protein ID: 163855785
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1478
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1530709..1531308 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA9IFX3
KEGG IDbpt:Bpet1478
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|163855785|ref|YP_001630083.1| unnamed protein product [Bordetella petrii DSM 12804]
MCPSPPWFHHPERRLLAGVLGLLWSVLAAGCATTTAPPPPDAFEEVLAAPESEAPEYIPVVRYGRYTLVE
LAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYSLCQTAHAVIELYALPLPAAHLHLGPMTLR
DALLTLAGPAWELHVDDRARQICFERPADSAAIEPASESPAAEAVQTFPLEPSVSGGQP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1530709-1531308 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTGCCCCTCTCCACCTTGGTTTCACCATCCCGAACGCCGCCTGCTGGCGGGAGTCCTCGGCCTGCTCT
GGTCGGTGCTGGCTGCTGGCTGCGCGACGACGACTGCGCCGCCCCCGCCCGATGCCTTCGAGGAAGTCTT
GGCCGCGCCGGAATCCGAGGCGCCCGAGTACATCCCCGTCGTGCGCTACGGTCGCTACACGCTGGTCGAG
CTGGCACCCACGGCGGCGCAGCGGGACCTGCTGTTGCAGACCATCGACGTGTCCATGCCCGAAGATGCCC
GTGCCACCGTCGGCGATGGGCTGCGGCATGTGCTCAAGCGCAGCGGTTACAGCCTATGCCAGACGGCGCA
CGCGGTGATCGAGCTGTACGCGCTGCCGCTGCCGGCGGCGCACTTGCACCTCGGCCCCATGACCTTGCGC
GATGCGCTGCTCACACTGGCTGGCCCCGCCTGGGAACTGCACGTGGATGATCGCGCACGGCAGATTTGCT
TCGAACGGCCTGCCGACAGCGCGGCCATCGAACCCGCATCCGAGTCACCCGCCGCCGAGGCGGTGCAGAC
GTTCCCGCTGGAGCCTTCTGTTTCGGGAGGCCAGCCATGA
 Primer design