SecReT4
Protein ID: 163855787
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1480
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1531970..1532689 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA9IFX7
KEGG IDbpt:Bpet1480
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|163855787|ref|YP_001630085.1| unnamed protein product [Bordetella petrii DSM 12804]
MKPSIVLSAFLLASTQLPAWAQQPSAAPARNAQSQERPLVARTPNDQVASEWGLQPQEWARYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDDAWQRLNPGMQRVNLPDDKPG
AVRSSGRMAVFVKDGCVACGQLVQRLQSSGTEFDLYMVGSRQDDARIRDWAKRAQIDPARVRSGSITLNH
DGGRWLSLGLPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 720 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1531970-1532689 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCCGTCGATCGTCCTTTCCGCGTTCCTGTTGGCATCCACCCAGTTGCCCGCCTGGGCGCAGCAGC
CGTCCGCCGCCCCGGCCCGCAATGCGCAGAGCCAGGAGCGTCCGCTGGTCGCCCGAACCCCGAACGACCA
GGTAGCAAGTGAGTGGGGCCTGCAACCGCAGGAATGGGCGCGCTATCGTGAGCTGATGGACGGGCCATTG
GGCATCTACTCGCCCAACCTGGACCCGCTGTCCGCGCTGGGCATCGAGGCCCGCACCGATGAAGAACGGC
GGCGCTACGCAGAACTGCAGGTGCAGGTCGAAGCACGCCGCGTCGAGAAATTGCTCGCCTACCAGCGCGC
CTACGACGATGCCTGGCAGCGCCTGAACCCCGGCATGCAACGGGTGAACCTGCCTGACGACAAGCCCGGC
GCAGTGCGCAGCAGCGGCCGTATGGCGGTGTTCGTCAAGGACGGCTGCGTGGCCTGCGGGCAACTCGTGC
AGCGCCTGCAATCCTCGGGTACTGAGTTCGACCTGTACATGGTCGGCAGCCGCCAGGACGACGCGCGCAT
CCGCGACTGGGCCAAGCGCGCGCAGATCGACCCGGCACGGGTGCGCAGCGGCAGCATCACGCTCAACCAT
GACGGCGGCCGCTGGCTGTCGCTGGGCCTGCCCGGCGATCTCCCAGCGGTCGTGCGCGAGGTGAACGGCC
AATGGCAGCGCCAACCCTGA
 Primer design