SecReT4
Protein ID: 163855788
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1481
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1532671..1533261 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA9IFX9
KEGG IDbpt:Bpet1481
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|163855788|ref|YP_001630086.1| unnamed protein product [Bordetella petrii DSM 12804]
MAAPTLTAPLRALVLAAGLCVCAARAQEIPPPAYQLAAQRAGIPSAVLYAVALQESGIRRNGRIVPWPWS
LNVAGQSRRYATRADACAGLQQAMRSTPHTRIDVGLGQINLGYQQQRYASACDLLDPYRNLAIAAEILKE
QHTAGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGTHPTAAVLAARQETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1532671-1533261 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAGCGCCAACCCTGACGGCGCCGTTGCGCGCACTGGTGCTCGCTGCTGGCCTCTGCGTCTGCGCCG
CCCGGGCCCAGGAAATTCCACCACCGGCCTACCAGCTTGCCGCCCAGCGCGCGGGCATTCCCTCGGCGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGGCGTAACGGACGCATCGTCCCGTGGCCTTGGTCC
CTCAACGTCGCCGGCCAGTCGCGCCGCTACGCGACCCGCGCCGACGCCTGCGCCGGTTTGCAGCAGGCGA
TGCGCTCCACGCCGCACACGCGCATCGACGTGGGCCTGGGTCAGATCAACCTCGGCTACCAACAGCAGCG
TTACGCCAGCGCGTGCGACTTGCTCGACCCGTACCGCAACCTCGCCATCGCTGCCGAGATTCTGAAGGAG
CAGCACACCGCCGGTGAGGACTGGTTGCTGGCGATCGGCCGCTACCACCGTCCGGCGGGCGGTGAGCCCG
CTGCCCGCTATCGCCGCAGCGTGTCCCGCCACCTCGCGCGCGTGCAGGGCACGCACCCAACCGCCGCGGT
CCTCGCCGCGCGCCAGGAGACCTCCCCATGA
 Primer design