SecReT4
Protein ID: 163855789
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1482
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1533258..1533806 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA9IFY0
KEGG IDbpt:Bpet1482
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1e-52, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|163855789|ref|YP_001630087.1| unnamed protein product [Bordetella petrii DSM 12804]
MTKSHLAHLAAKGLLVLLAGLPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPARSPVPAPQIPA
TPADEAAMLPVRSAKLTSGTVARRVIEAPGLRPFVVVGDDEASQAWLRRHAASLRERGAVGLVVNVETVQ
GLERLRALAPGVPLAPVSGDDLAERLGLRHYPALITATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1533258-1533806 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGAAATCCCATCTGGCCCATCTCGCGGCGAAAGGCCTGCTCGTGCTGCTGGCTGGTCTGCCGCTGG
CCTCGCGTGCCGGCGAGCCGCTGATCGTGGTCGAAGACCGTGGCGGCACGTCGGCGCTGCCGTACTACGA
AGCCCTGAACCTTCAGCCGCGCGCCAACGCTCCGGCCCGGTCGCCCGTCCCGGCGCCTCAGATCCCTGCC
ACACCGGCGGACGAGGCCGCGATGCTGCCGGTGCGTAGCGCCAAGCTCACGTCCGGCACCGTCGCGCGGC
GGGTGATCGAGGCGCCGGGCCTGCGTCCCTTTGTGGTCGTGGGCGACGACGAGGCTTCCCAGGCCTGGTT
GCGCCGCCATGCAGCCTCATTGCGCGAGCGCGGCGCGGTCGGTCTGGTGGTCAACGTCGAGACCGTCCAG
GGCCTGGAGCGGCTGCGCGCACTGGCACCCGGCGTCCCCCTCGCGCCCGTGTCCGGTGACGACTTGGCCG
AGCGCTTGGGCCTGCGGCACTACCCGGCGCTGATCACGGCCACCGGCATCGAGCAATGA
 Primer design