SecReT4
Protein ID: 163855790
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1483
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1533811..1535997 [+]
Productplasmid-transfer-protein
Component typeTfc6
UniProt IDA9IFY3
KEGG IDbpt:Bpet1483
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 8.8e-15, Aligned region: 507..637
TrwB_AAD_bind [PF10412], Evalue: 9.1e-10, Aligned region: 509..649
AAA_10 [PF12846], Evalue: 3.6e-09, Aligned region: 191..584
Protein Sequence: 728 a.a.     [Download]
>gi|163855790|ref|YP_001630088.1| unnamed protein product [Bordetella petrii DSM 12804]
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYRDARVILRYRR
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLTRRLEERLEFAR
FPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNAAGEHEVVIVIDPKGDADLLKRMYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HIVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGAL
PDDLLDDAAAVEPGLVATDDSAGNEASP
 
Nucleotide Sequence: 2187 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1533811-1535997 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCGGGGAAACAGCCGGTCGAGGTGCTGCTTCGCCCAGCGGTGGAGCTATATACCGTCGCGGCGTGTG
CGGGCGCCGCGTTTCTGTCCCTGGTGGCCCCGTGGTCGCTCGCGCTGAGCCCCGCCATGGGTGTCGGCAG
CGCGTTGGCGTTCGGGGCCTATGGCGCGATCCGCTACCGCGATGCCCGCGTCATCCTGCGCTACCGGCGC
AACATCCGCCGCCTGCCGCGCTACGTGATGACCAGCAAGGACGTGCCGGTCAGCCAGCAACGTCTGTTTG
TGGGGCGCGGCTTTTTGTGGGAGCAGAAACACACCCATAGGCTCATGCAGACATACCGGCCGGAGTTTCG
GCGCTACGTCGAGCCGACGCCGGCCTACCGACTGACGCGGCGCCTGGAGGAACGGCTGGAGTTCGCGCGG
TTCCCGCTTTCCCGGCTGCCGAAACTCACCGGCTGGGACGTGCCTTTCAACCCAGTGCGCCCGCTGCCGC
CCGTGGGCGGACTGCCTCGGCTGCACGGCATCGAACCCGAGGAGGTGGACGTCAGCCTGCCGCTCGGCGA
GCGCGTCGGGCACTCATTGGTCTTGGGGACAACCCGCGTGGGCAAGACGCGGCTGGCCGAACTGTTCGTG
ACCCAGGACATCCGGCGAAAGAACGCGGCGGGAGAGCACGAGGTCGTGATCGTCATCGACCCCAAAGGGG
ATGCCGATCTGCTGAAGCGGATGTACGTCGAGGCGCAACGCGCGGGCCGCGAGGGCGAGTTCTATGTCTT
CCATTTGGGCTGGCCGGACATTTCCGCCCGCTACAACGCCGTGGGGCGCTTTGGACGTATCAGCGAGGTG
GCGACCCGCATTGCAGGGCAACTCTCCGGTGAAGGCAACTCGGCGGCTTTCAGGGAATTTGCCTGGCGCT
TCGTCAACATCATCGCCCGCGCCTTGGTGGAACTGGGGCAGCGTCCGGACTACATGCTGATCCAGCGGCA
TGTCATCAACATCGACGCGCTGTTCATCGAGTACGCCCAGCACTACTTCGCCAAGACGGAGCCGAAAGCC
TGGGAGGTGATCGTCCAGATCGAGGCCAAGCTCAACGAGAAGAACATCCCGCGCAACATGATCGGGCGCG
AGAAGCGCGTGGTGGCGCTGGAGCAGTACCTGTCCCAAGCCCGCAACTACGACCCTGTGCTGGACGGTTT
GCGCTCTGCCGTGCGGTACGACAAGACGTATTTCGACAAGATCGTCGCCAGCCTCTTGCCTCTGCTGGAA
AAACTCACGAGCGGCAAGATCGCGCAGCTCCTGGCCCCGAACTATTCCGACCTGGCCGACCCGCGCCCGA
TCTTCGATTGGATGCAGGTCATTAGGAAGCGGGCCATCGTCTATGTGGGCCTGGACGCGCTGTCCGATGC
CGAGGTCGCCGCAGCGGTCGGCAACTCGATGTTCAGCGATCTCGTCTCGGTCGCAGGCCATATCTACAAG
CACGGGATCGACGATGGCCTGCCGGGCGCTTCGGCCGGCGCGCGCGTGCCGATCAACGTCCATGCCGATG
AGTTCAACGAGTTGATGGGTGACGAGTTCATTCCGCTGATCAACAAAGGTGGTGGCGCCGGGCTGCAAGT
CACCGCGTACACGCAGACCCTCTCGGACATTGAGGCCCGCATTGGCAACCGCGCCAAGGCCGGTCAGGTC
ATCGGCAACTTCAACAACCTGTTCATGCTGCGCGTGCGCGAGACCGCGACCGCTGAACTGCTGACCCGGC
AACTACCGAAGGTCGAGGTTTATACGACCACCATCGTCAGCGGCGCGACCGACAGCTCGGACATTCGCGG
GGCGACGGATTTCACGTCCAACACTCAGGACCGCATCAGCATGTCCAGCGTGCCGATGATCGAGCCGTCG
CACATCGTCGGCTTGCCCAAGGGCCAGTGTTTTGCATTGTTGCAGGGCGGCCAACTTTGGAAGGTTCGCA
TGCCGCTGCCGGCACCGGACCCCGATGAGGTCATGCCACAGGATCTGCAACAACTCGCGGGCTACATGCG
CCAGAGCTACAGCGAGGCCACGCAGTGGTGGGAGTTCACCAGCTCCCCGGCGCTGCAGGACGGGGCCTTG
CCCGACGACCTGCTGGATGATGCTGCTGCGGTCGAACCTGGCCTTGTGGCCACCGACGACAGCGCCGGCA
ACGAGGCCTCGCCATGA
 Primer design