SecReT4
Protein ID: 163855791
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1484
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1535994..1536743 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA9IFY5
KEGG IDbpt:Bpet1484
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.4e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|163855791|ref|YP_001630089.1| unnamed protein product [Bordetella petrii DSM 12804]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSNHFTRSVVVREPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSHGQTRNFRYYISQVYVWTES
YLIAAAFTTLTFLVRLLVLVLTLPLISTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPIAVLP
WVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1535994-1536743 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAAGGCCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTGATCGGCTCACTGCTGTTCTCCATCGTCGTGGAATGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGTCACTCCCAGCAGATGTTGCAGTACGAGCTGGGGCAC
CTGTCCAACCACTTCACGCGCAGCGTCGTCGTGCGGGAGCCAGGGCGCACGGCGCATGAGCTGGTGGACA
CCGGCTACGAATGGGTATTCGTGCGCTCGGGACTGCTGGAACGCATGAGCCAGACCGCCGAGCGTGCCCG
TGCGCCCAGCCACGGGCAGACGCGCAACTTCCGCTATTACATCAGCCAGGTCTATGTCTGGACCGAGAGC
TACCTGATCGCCGCGGCCTTCACGACGCTGACCTTCCTTGTGCGCCTGCTGGTCCTTGTGCTCACGTTGC
CGCTGATCTCCACTGCGGCGTTCGTCGGCCTGATCGACGGCTTGGTGCGCAGGGACGTGCGCCGGTTCGG
CGCGGGCCGCGAATCGGGTTTCATCTACCACCGTGCGAAAGCCAGCCTGATGCCCATAGCCGTTCTGCCC
TGGGTCACGTACCTGGCCTTGCCGATCTCGGTACACCCATTACTGATCCTCTTGCCGAGCGCCGCCTTGC
TGGGACTGGCGGTGTCTCTGACTGCGGGGAGCTTCAAAAAGTACCTGTGA
 Primer design