SecReT4
Protein ID: 163855793
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1486
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1537370..1537753 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9IFY8
KEGG IDbpt:Bpet1486
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.7e-29, Aligned region: 31..109
Protein Sequence: 127 a.a.     [Download]
>gi|163855793|ref|YP_001630091.1| unnamed protein product [Bordetella petrii DSM 12804]
MVALTWLRAAHRGVPTFLVMALLLGQSPMALGESPAQRQELVAALRQLDALERTVADSAAHASIQPGERY
HFDYPRLLADLARMRAGIQAHLTPSRAQPRDTSELAGGYRTERAVEGSLPTTVENKP
 
Nucleotide Sequence: 384 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1537370-1537753 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGTGGCTTTAACCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGATGGCCCTCCTGC
TGGGCCAGTCCCCGATGGCGTTGGGCGAGTCCCCGGCGCAGCGCCAGGAGTTGGTCGCCGCGCTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCCGACAGCGCCGCGCATGCCTCCATCCAGCCGGGCGAACGCTAT
CACTTCGATTACCCGCGGCTGCTGGCTGATCTAGCGCGTATGCGCGCTGGCATCCAGGCCCACCTTACCC
CGTCGCGTGCCCAGCCGCGCGACACCTCCGAACTGGCCGGCGGCTACCGCACCGAGCGGGCCGTCGAGGG
ATCGCTGCCGACGACTGTGGAGAACAAGCCATGA
 Primer design