SecReT4
Protein ID: 163855796
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1489
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1538372..1538782 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9IFZ4
KEGG IDbpt:Bpet1489
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.7e-49, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|163855796|ref|YP_001630094.1| unnamed protein product [Bordetella petrii DSM 12804]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIALAPTFVVLG
VAFGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLVAGWVGGHVLISRSGFWTTRRSAARGSR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1538372-1538782 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCTGACGGGACGGTCACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTTGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGTGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCGCTTGCACCCACGTTCGTCGTGCTGGGC
GTGGCCTTCGGCGTGTTCATCGGGGGCGGCATCCTGCGTCGCCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTATCGGCAACTCCAGTGGCGCATCGCCACGCGCCACCCGCTGGTGGCAGGCTGGGTGGGCGGCCATGT
ACTGATCTCACGCTCCGGCTTCTGGACCACCCGAAGGTCTGCAGCAAGGGGGTCACGATGA
 Primer design