SecReT4
Protein ID: 163855798
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1491
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1539468..1540400 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA9IFZ8
KEGG IDbpt:Bpet1491
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.4e-126, Aligned region: 11..291
Protein Sequence: 310 a.a.     [Download]
>gi|163855798|ref|YP_001630096.1| unnamed protein product [Bordetella petrii DSM 12804]
MKHPVFKLPGLLAVAAAVVMSSAAQAVEILRWERMPLAVPLKVGQERVVFIDKNVRVGVPAGVSERLRVQ
SAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGNSTPARYGDQPGDADD
APARAQDPTGTRATRRETPVPVVLTRYAAQNLYAPLRTVEPLPGVMRVNLRRDFDLGTLMPTLPVRAVAL
ASWRLEDQWVTAVRLTNSSGGWITLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLL
PAINRFDPAAHLPQPEAEATTASKESRHAQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1539468-1540400 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCACCCTGTATTCAAGCTGCCGGGGCTGTTGGCCGTGGCCGCCGCAGTGGTCATGTCCTCCGCTG
CCCAGGCGGTGGAAATCCTGCGCTGGGAACGCATGCCGCTGGCGGTGCCCTTGAAGGTCGGCCAGGAGCG
CGTCGTGTTCATCGACAAGAACGTCCGCGTCGGCGTGCCCGCTGGCGTCAGCGAACGCCTACGGGTGCAG
AGCGCGGGCGGCGCGGTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACACGGCTGCAACTGCAGGACG
CCGACACGGGCGCGCTGATCCTGCTGGACATTGCGGCCGAGCCGCCCAAGGACGGGGAAGCCGAGCTGGA
GCCGGTGCGCATCGTCGAGGGCAACAGCACCCCGGCACGCTATGGCGATCAGCCCGGCGATGCCGACGAT
GCCCCGGCACGCGCCCAGGACCCGACAGGCACGCGGGCAACGCGCCGCGAAACCCCGGTTCCGGTCGTGC
TGACGCGCTATGCCGCGCAAAACCTCTACGCACCGCTGCGCACTGTGGAGCCGCTACCGGGCGTCATGCG
GGTGAACCTGCGCCGCGACTTCGACCTCGGCACGCTGATGCCGACGCTGCCGGTGCGCGCGGTCGCGCTC
GCGTCGTGGCGTCTGGAAGACCAGTGGGTCACGGCCGTGCGCCTGACCAATAGCAGCGGCGGCTGGATCA
CTCTCGACCCCCGCGTGCTGCAAGGCGACTTCCTCACCGCCACCTTCCAGCACGAAGCACTCGGCCCGCG
CGGAACGCCCGAGGACACGACCGTGCTGTACCTGGTGACGCGCGGGCACGGCCTTGCCCAGTCGCTGCTG
CCGGCGATCAACCGCTTCGACCCAGCCGCGCATTTGCCGCAACCCGAAGCCGAGGCCACCACCGCCAGCA
AGGAGTCCCGCCATGCGCAGTAA
 Primer design