SecReT4
Protein ID: 163855799
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1492
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1540390..1541808 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDA9IG00
KEGG IDbpt:Bpet1492
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 472 a.a.     [Download]
>gi|163855799|ref|YP_001630097.1| unnamed protein product [Bordetella petrii DSM 12804]
MRSNGLLKWLMIPVALLVLFVAIRMFSGGSSSAPPAADAGAKLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTVLSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQQQAASERQQTEGLLADLQRRL
ESIGGRGGGHADLPVGLGLRDGDEAGMEGGVRWVEPNDAKPADGRNGSRATGGGTSFPTSFGPAQSTLET
TAKTVANAGARAAGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDRDGNQQNNQQRDGLGWISDPYGIPCV
SGERRSNAQQYLGSQALITAAGAGVASLIDSDSGQMSYVGADGSIGSVGISSNEAVGRILAGGVRDMADW
VNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1540390-1541808 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCGCAGTAACGGACTCCTGAAGTGGTTGATGATCCCCGTGGCCCTGCTGGTGCTGTTCGTCGCCATCC
GGATGTTTTCGGGTGGAAGCTCGTCTGCGCCTCCCGCCGCGGATGCCGGCGCCAAGCTCACGCCGGAGGA
AATGAAGGCGCTGGGCATCGAGGGCGATACCCCCCGCGATACCGTAGCGACGCTCGTGGCGCAGGTGAAG
CAGTTGCGCACCGAGCTTCAGACGGTCCTGTCCGACAACAAGTCCCAGCGCGAGGAGAACCAGCGCCTGC
GCCAACGCGAGAACTCGATCGACCAGCGCATCAATTCGGCCCTCGAATCCGAGCGCTCCAACCTGCGCCG
CGACCAGCAGCAGGCGGCCAGCGAGCGCCAGCAGACCGAGGGGCTGCTCGCCGACCTACAGCGGCGCTTG
GAAAGCATCGGCGGGCGTGGCGGCGGCCACGCCGATCTACCCGTGGGCCTGGGACTGCGTGACGGCGACG
AGGCAGGCATGGAAGGCGGCGTGCGCTGGGTCGAGCCGAACGACGCTAAGCCCGCTGATGGGCGTAACGG
CAGTCGTGCCACGGGTGGCGGCACGAGCTTTCCGACGAGCTTCGGCCCTGCGCAGAGCACGCTGGAAACC
ACGGCGAAAACCGTGGCGAACGCGGGCGCCCGCGCCGCAGGCGTCAAGAGCGCCAAGCCGGTCTATACGG
TGCCTACCAACTCGACGCTGATGGGGTCGGTGGCTATGACGGCGCTGATCGGCCGCGTGCCGATTGACGG
CACGGTCAACGATCCGTATCCGTTCAAAGTCCTGGTCGGCCCCGACAACCTCACGGCAAACGGCATCGAC
ATTCCCGATGTGGCCGGCGCCGTGTTTTCCGGCACTGCCTCGGGCGACTGGACGCTCTCTTGTGTGCGCG
GCCAGGTGCGCAGCATCACCTTTGTGTTCCATGACGGAACCATTCGGACGATTCCCGAAGACCGCGACGG
CAACCAGCAGAACAATCAGCAGCGCGACGGATTGGGCTGGATCAGCGACCCGTATGGCATTCCTTGCGTC
AGTGGAGAGCGGCGCAGCAACGCCCAGCAATACCTCGGTTCGCAGGCGCTCATCACCGCGGCGGGTGCGG
GCGTGGCCTCGCTTATCGACAGCGACAGCGGCCAGATGTCCTACGTGGGCGCAGACGGTTCCATCGGCAG
CGTCGGCATTTCCAGCAACGAAGCCGTAGGTCGCATCCTGGCCGGTGGCGTGCGGGACATGGCCGATTGG
GTGAACAAGTTGTACGGCCAGGCCTTCGCCGCCGTCTATGTCCAACCCGGCGCGAAGGTCGCCGTCCATC
TCGAAAAGCCGCTCGCCATCGATTTCGATCCCGAAGGCCGCAAGGTCGATCACCGCGCAGGAGAAAGCCA
TGCTCTCGAACTTGAATAA
 Primer design