SecReT4
Protein ID: 163855800
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1493
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1541789..1542229 [+]
Productlipoprotein
Component typeTfc15
UniProt IDA9IG02
KEGG IDbpt:Bpet1493
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|163855800|ref|YP_001630098.1| unnamed protein product [Bordetella petrii DSM 12804]
MLSNLNKGLALALAVAVLGGCATSKEKLLPHGDSTMMDIWQTNAGDGGGGAGQVARRQLLDARQSLRRPL
TDADVQAAPAEQMRYTRTARNEVYRQFQRLPNPDLVMYVYPHLAGTDPVPVPGYTTVFPLYQRVQYAMPG
ERVEDY
 
Nucleotide Sequence: 441 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1541789-1542229 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCTCTCGAACTTGAATAAGGGCCTGGCGCTGGCTCTTGCCGTCGCGGTGCTCGGCGGCTGCGCCACCA
GTAAGGAAAAGCTGCTGCCGCACGGCGACAGCACAATGATGGACATCTGGCAGACCAACGCCGGCGACGG
CGGCGGTGGCGCCGGCCAAGTGGCGCGCAGGCAATTGCTCGATGCACGCCAGAGCCTGCGCCGGCCGCTG
ACCGACGCCGACGTGCAGGCCGCGCCCGCCGAGCAGATGCGCTACACGCGGACCGCGCGCAACGAGGTCT
ATCGCCAGTTCCAGCGTCTGCCCAATCCCGACCTGGTGATGTACGTGTACCCGCATCTGGCGGGCACGGA
CCCCGTGCCGGTTCCGGGCTACACGACGGTCTTCCCCCTCTACCAGCGCGTGCAGTACGCCATGCCGGGC
GAGCGCGTGGAGGACTACTGA
 Primer design