SecReT4
Protein ID: 163855801
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpetpseudo_04
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1542229..1543317 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1e-67, Aligned region: 61..335
Protein Sequence: 362 a.a.     [Download]
>gi|163855801|ref|YP_001630099.1| unnamed protein product [Bordetella petrii DSM 12804]
MRWKLPWPKLAASGAGEDEQPDGWQRHVETLRQAGIPEPGAAVQDRRPATLADEQALYDVAPSFTELLPW
VEFLPQSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQDEP
SFDQYMQTLRDYVQPRARGTAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRAT
GQASRRGQTPEQMLNIVCDRLCGGLANAGIQARRMDAAGVHDWLLRWFNPRPTLLGPGVEDRERFYALAR
YPDETEEGEIELASGRDFSQRLFFGQPRSDVAHGTWHFDGMPHRVLITDRLRMPPGTGHLTGETRKGDAI
NTELARKKWIPC
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1542229-1543317 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCGCTGGAAACTCCCCTGGCCGAAGCTGGCCGCATCCGGCGCTGGCGAGGACGAGCAGCCGGACGGCT
GGCAGCGCCACGTCGAGACCTTGCGACAGGCCGGCATCCCTGAACCCGGCGCGGCGGTCCAGGACCGCAG
GCCGGCGACCTTGGCAGACGAGCAGGCGCTGTACGACGTCGCGCCGTCCTTCACGGAACTGCTGCCTTGG
GTGGAGTTTCTGCCCCAATCGAAGTCCATGCTGCTGGAGGACGGGCAATCGGTCGCGGCCTTCTACGAGC
TGGTGCCGCTGGGCACCGAAGGTCGGGAACCCGGCTGGCTCGCGCATGCCCGAGATGCGCTCGAAAACGC
GCTGCAAGACTCGTTCGACGAACTGGACGAGAACCCCTGGGTGCTTCAGCTCTACGCGCAGGACGAGCCC
AGCTTCGACCAGTACATGCAGACCCTGCGCGACTACGTGCAGCCGCGCGCCCGCGGCACGGCGTTCACGG
AGTTCTATTTGCGCTTCTTCGGCCACCACCTGCGGGCGGTGGCCAAGCCGGGCGGGCTGTTCGAGGACAC
GGTGGTCACGCGGCTGCGCTGGCGGGGTCAGACGCGGCGCGTGCGCATGGTCGTCTATCGCCGGGCCACC
GGACAGGCGAGCCGCCGCGGCCAGACGCCAGAACAAATGCTCAATATCGTCTGCGACCGCCTGTGCGGCG
GGCTGGCGAACGCTGGCATCCAGGCTCGGCGCATGGATGCGGCCGGGGTTCACGATTGGCTTTTGCGCTG
GTTCAACCCGCGCCCAACTCTGCTGGGGCCGGGCGTGGAAGACCGCGAGCGGTTCTACGCGCTCGCGCGC
TACCCTGACGAGACCGAGGAAGGCGAGATCGAGCTTGCGAGCGGGCGTGATTTCAGCCAGCGGCTGTTCT
TCGGCCAGCCGCGATCCGACGTGGCGCACGGCACCTGGCACTTCGACGGCATGCCGCATCGCGTGCTGAT
CACCGACCGCCTGCGCATGCCGCCCGGCACGGGGCACTTGACCGGCGAAACCCGCAAGGGCGATGCGATC
AACACTGAGCTTGCCCGCAAAAAATGGATCCCTTGCTGA
 Primer design