SecReT4
Protein ID: 163855804
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpetpseudo_05
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1544570..1546381 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-46, Aligned region: 177..516
Protein Sequence: 603 a.a.     [Download]
>gi|163855804|ref|YP_001630102.1| unnamed protein product [Bordetella petrii DSM 12804]
MFDQMPEDTLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYRGTLAFYL
RGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRKWYTQLMFAQHAANLS
PVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPRLF
IVEAGNSFGLFSDFAKRLGLTVNRVKLSPGSGISLAPFADARRLIETPSDVQTLDADALDEDLPPDASAM
EADEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRARG
QDPTLPEMRRVRLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLIS
TVNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPMLNM
IEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAVPPSLYLALAQTE
PEEKADRYQLMQQYGCTELEAAFKVAEKIDQARGIESPALELS
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1544570-1546381 Bordetella petrii DSM 12804 chromosome, complete genome
CTGTTCGACCAGATGCCGGAAGACACGCTGATGTGTCTCACGATGGTTGCCACACCGCAGGATGTCCTGG
AAGCGGACCTCAACCACCTGGCAAAGAAGGCCGTGGGAGAGACGCTGGCGTCGGAGCAGACGCTCAAGGA
CGTGCAGGAGGCCCGCTCGCTGATCGGCAGCGCGCATAAGCTCTACCGGGGAACTCTGGCGTTCTACCTG
CGCGGGCGCGACGAGGCGGAACTGGACCGGCGCGGGCTGGACTTGGCGAACGTCATGCTCAATGCCGGCT
TGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCGCTCAACAGCTACTTGCGCTGGCTACCGTGCTGCTA
CAACCCCGGCCAGGATCGGCGCAAGTGGTACACCCAACTGATGTTCGCCCAGCACGCGGCGAACCTGTCG
CCGGTGTGGGGCCGCGCCCAGGGTACGGGGCACCCCGGCATCACGATGTTCAACCGCGGTGGTGGGCCGA
TCACCTTCGACCCGCTCAACCGCCTGGACCGGCAGATGAACGCGCATCTGTTCCTGTTCGGTCCCACCGG
CTCCGGTAAGAGCGCCACACTCAACAACCTCTTGAACCAGGTCACGGCCATCTACCGGCCGCGCCTCTTC
ATCGTGGAAGCCGGCAACAGCTTCGGCCTGTTCAGCGATTTCGCCAAGCGCCTGGGCCTCACCGTAAACC
GGGTCAAGCTGTCACCTGGCTCGGGCATCAGCCTCGCGCCATTCGCCGATGCGCGCCGGCTGATCGAGAC
GCCAAGCGACGTGCAGACGCTCGATGCCGATGCGCTGGATGAAGACCTACCACCGGATGCCTCGGCCATG
GAGGCGGACGAACAGCGTGACGTGCTGGGCGAACTGGAGATCACGGCGCGTTTGATGATCACGGGCGGCG
AAGACAAGGAAGAAGCCCGGATGACGCGGGCCGATCGCTCGCTCATCCGCCAGTGCATCCTCGACGCCGC
CGAGCACTGCGTGGCCGAGAAGCGCACGGTCCTCACGCGCGACGTGCGCAATGCGCTGCGCGCCCGGGGC
CAGGACCCGACACTGCCCGAGATGCGCCGCGTGCGGCTGCTGGAGATGGCAGACGCGATGGACATGTTCT
GCCAAGGCACGGACGGCGAAATGTTCGACCGCGACGGCACGCCGTGGCCCGAAGCCGACATCACGCTGGT
GGATCTGGCGACCTACGCTCGTGAGGGCTACAACGCCCAGCTCTCCATCGCTTACATCAGCCTGATCAGC
ACGGTGAACAACATCGCCGAGCGCGACCAGTATCTGGGCCGCCCGATCATCAACGTGACCGACGAAGGGC
ACATCATCACGAAGAACCCGCTGCTCGCGCCCTACGTGGTCAAGATCACGAAGATGTGGCGCAAGTTGGG
GGCCTGGTTCTGGCTCGCGACGCAGAACATCGACGACCTGCCGCGTGCCGCAGAGCCCATGCTCAACATG
ATCGAGTGGTGGATCTGCCTGTCGATGCCGCCGGACGAGGTGGAGAAGATCGCCCGGTTCCGCGAACTCT
CGCCCGCGCAGAAGGCGCTGATGCTTTCGGCGCGCAAAGAGGCGGGGAAATTCACCGAGGGCGTCATCCT
CTCCAAGAGCATGGAAGTGCTCTTCCGCGCTGTGCCGCCAAGCCTCTACCTCGCGCTCGCGCAAACCGAA
CCCGAAGAGAAGGCCGACCGCTACCAGCTCATGCAGCAATACGGCTGCACCGAACTGGAAGCGGCCTTCA
AGGTGGCCGAGAAGATCGACCAGGCACGCGGCATCGAGTCGCCAGCCCTGGAACTGTCGTAA
 Primer design