SecReT4
Protein ID: 163855810
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1501
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1551600..1552046 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDA9IG22
KEGG IDbpt:Bpet1501
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 5.6e-40, Aligned region: 35..145
Protein Sequence: 148 a.a.     [Download]
>gi|163855810|ref|YP_001630108.1| unnamed protein product [Bordetella petrii DSM 12804]
MPASFSRFSPRWRTLGLAVALPVALAAFCPATFAADVLVVTDSRHPLKTMGGERLIELDEAHRIEAELSV
ELPADSEQAAAVVKRRLNSGGADLQRRIASAYQGVTDAWSLGITSIPAVVVDQRYVVYGEPDVARAVARV
QQHRRAQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1551600-1552046 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCCAGCTTCTTTTTCCAGGTTCTCGCCGCGCTGGCGAACCCTCGGCCTGGCCGTTGCGCTGCCGGTGG
CGTTGGCCGCTTTTTGCCCGGCCACCTTCGCCGCCGACGTGCTGGTCGTCACCGACAGCCGGCACCCCCT
CAAGACCATGGGCGGCGAACGGCTGATCGAGCTGGACGAAGCGCATCGGATTGAAGCGGAGCTTTCTGTC
GAACTCCCCGCCGATTCTGAACAGGCTGCCGCCGTCGTCAAGCGTCGGCTGAATAGTGGCGGTGCCGACC
TCCAGCGCCGCATTGCGTCCGCATACCAGGGCGTCACCGACGCATGGAGCCTGGGCATCACCAGCATCCC
AGCCGTCGTGGTGGACCAGCGCTACGTGGTCTATGGCGAGCCGGACGTGGCCCGCGCCGTCGCGCGCGTT
CAGCAGCACCGGAGGGCTCAGCCGTGA
 Primer design