SecReT4
Protein ID: 163855811
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1502
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1551923..1552990 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA9IG24
KEGG IDbpt:Bpet1502
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 8.8e-95, Aligned region: 73..343
Protein Sequence: 355 a.a.     [Download]
>gi|163855811|ref|YP_001630109.1| unnamed protein product [Bordetella petrii DSM 12804]
MEPGHHQHPSRRGGPALRGLWRAGRGPRRRARSAAPEGSAVTRAFDLMRRLRAGVASVLLLSATGSYALN
TATIVGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSIKVRHYIPDAVVSSYSNTGENPWIEVRPMSTPN
PSAQAGGDGTTNEDHENNLAKFKNADVIGHPGAEVFNQFVSSSGYFCEGAGTAFMPYLLSTLDTLAWRYN
VPEMAYPEALIPGMREVGARTTMNLWGNVYPRGGFLHQTDDHKTGAVIAQRAGDVVTRRGQLHVYQPLLA
NPRDGYWPAGALMEGDASTGKWQELTPVLSSSCSVFPRSGSLTQAQQGDYAWALWRPYACCERRGQVFLG
SVDFL
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1551923-1552990 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGAGCCTGGGCATCACCAGCATCCCAGCCGTCGTGGTGGACCAGCGCTACGTGGTCTATGGCGAGCCG
GACGTGGCCCGCGCCGTCGCGCGCGTTCAGCAGCACCGGAGGGCTCAGCCGTGACTCGTGCATTCGACCT
GATGCGCCGCCTGCGTGCTGGCGTGGCGTCCGTGCTGCTGCTCAGCGCCACGGGCAGCTACGCGCTCAAC
ACCGCAACCATCGTCGGCTCGGTGGCATCTCCAGACTGCCTCGAATACCGCGTCGTCGGGATCTGCTACT
GGCTCTACTGTACCTGGACGGGCTGTACGGTACGCACGTCCATCAAGGTCCGCCACTACATCCCCGATGC
GGTCGTCTCCAGCTACAGCAACACCGGCGAAAACCCCTGGATCGAAGTCCGGCCGATGAGCACGCCCAAC
CCATCCGCCCAAGCCGGCGGGGACGGAACGACGAACGAGGACCACGAAAACAACCTCGCCAAGTTCAAGA
ATGCGGACGTCATCGGCCACCCGGGCGCCGAGGTGTTCAACCAGTTCGTGTCGTCCTCGGGCTACTTCTG
CGAGGGTGCGGGCACGGCGTTCATGCCGTACTTGCTCAGCACCCTGGACACGCTGGCCTGGCGCTACAAC
GTGCCCGAGATGGCCTACCCGGAGGCGCTGATTCCTGGCATGCGCGAGGTCGGCGCACGCACCACGATGA
ACCTCTGGGGCAACGTGTATCCCCGCGGTGGTTTTCTGCACCAGACCGACGACCACAAGACCGGCGCAGT
GATCGCCCAGCGCGCAGGCGATGTCGTCACGCGCCGCGGGCAACTCCACGTCTATCAGCCGTTGCTTGCC
AACCCCCGCGATGGCTACTGGCCGGCTGGCGCGCTGATGGAGGGCGATGCCTCGACAGGCAAGTGGCAGG
AACTCACACCCGTCCTGTCATCGTCCTGCTCGGTCTTCCCGCGCAGCGGCTCCCTGACCCAGGCCCAGCA
GGGCGATTACGCCTGGGCGCTATGGCGGCCGTATGCGTGCTGCGAACGCCGGGGCCAAGTGTTTCTCGGC
AGCGTCGATTTCCTCTGA
 Primer design