SecReT4
Protein ID: 163855812
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1503
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1553000..1554397 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9IG26
KEGG IDbpt:Bpet1503
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|163855812|ref|YP_001630110.1| unnamed protein product [Bordetella petrii DSM 12804]
MKFRPAFNPFSPRVPRTKIVLALAGALALASGVAWGQLGYQTGGSVIGDDVMYSIGGGSAVSMGRAAGMQ
SIGVGVGWNSNLVCGDMSLQTTLRNQLNGITNGFQQIMGNVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSRMAEGLALRDAVSSTDAVSAIEQAETRRGNDGVPWV
GGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPTSCSSLSCQTWTSPQAAVEWATRVLGEKEQ
RTCDACTKTETTPGVGLTPLIQEEYDAKLQALQDLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPD
QHLLSQRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVESVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGTRAAGSRGIYEGDPIPDRLDRLQKGNPGGNP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1553000-1554397 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGTTTCGTCCTGCATTCAATCCGTTCTCCCCCCGTGTACCTCGCACGAAGATCGTTCTGGCGCTGG
CTGGTGCGCTGGCCTTGGCCAGCGGCGTGGCCTGGGGCCAACTGGGCTACCAGACGGGCGGCAGCGTCAT
CGGCGATGACGTCATGTACTCCATCGGTGGCGGCAGCGCAGTGTCCATGGGACGTGCCGCAGGAATGCAA
TCGATCGGCGTGGGCGTGGGCTGGAACTCAAATCTCGTCTGCGGCGACATGAGCCTCCAGACCACTCTGC
GCAACCAGCTCAACGGCATCACGAACGGCTTTCAGCAGATCATGGGGAACGTGATCCAGAGCGCCACCAG
CGCCGTGGCATCCCTGCCTGCGCTGATCATTCAGCGCGCCGACCCGGGCTTGTACAACCTGCTCACCAAT
GGCGTGCTGCAAGCGCGGCTGGATTTCGACCGTTCCAAGCTGACGTGCCGCGCAATGGCCGAGAAGATGG
CCGACACAGCGGGCGGCCAGCTCGGCTGGAGCCGGATGGCAGAAGGTTTGGCGCTGCGCGATGCGGTGTC
AAGCACGGATGCGGTCTCGGCCATCGAGCAGGCCGAAACGCGCCGCGGCAATGACGGTGTGCCGTGGGTC
GGGGGTAGCAACGCGGGGGGCTCTGGTCAGCCCGCGATTAAGGTCGTCGGCGATGTCACCCGCGCCGGCT
ACAACCTAGTCAACGGCCGCGGCGTGACCGATACGTCGTCTATCGCACCGACCAGTTGTAGCAGCCTCTC
GTGCCAGACCTGGACCTCGCCGCAGGCCGCCGTCGAGTGGGCCACGCGCGTACTCGGCGAGAAGGAACAG
CGCACTTGCGATGCCTGCACCAAAACCGAGACGACGCCCGGCGTAGGACTGACGCCGCTGATCCAGGAAG
AGTACGACGCCAAGCTGCAGGCGCTCCAGGATCTGGTGTCCAAGGCGAAGAACACGACGCCCGAGAACCT
GCGCGAAGCTGGCAGTGCATCGCTGCCCATCACCCGCGGCGTCATCGAGGCGCTGCGCGACGAGCCGGAC
CAGCACCTGCTGTCGCAGCGCCTGGCGTCCGAGGTCGCGCTGTCCTCAGTGCTGGAGAAGGCGCTGCTGC
TACAGCGCACGCTGCTCACGGGCAAGAAAGAGCCCAACGTCGCGGCCAACGAGCTTGCGGTGGAGAGCGT
GAACAAGGAGAGCGATACGCTCGACCGCGAAATCCGCAACCTCAAGACCGAACTGGAGCTACGGCGCGAA
CTGGCGAATAACTCGCCCATGGCCATCATCCAGCGGCATGGCACGCGTGCGGCAGGCTCGCGCGGCATCT
ACGAGGGCGATCCCATCCCCGACCGTCTCGACCGGCTCCAGAAGGGCAATCCGGGAGGCAACCCATGA
 Primer design