SecReT4
Protein ID: 163855814
T4SS name [ID]Tfc [735]
Gene symbol-
Locus tagBpet1505
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]1554769..1556286 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA9IG29
KEGG IDbpt:Bpet1505
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.1e-127, Aligned region: 10..483
Protein Sequence: 505 a.a.     [Download]
>gi|163855814|ref|YP_001630112.1| unnamed protein product [Bordetella petrii DSM 12804]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVIQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLSTIQYDSSRSAQCQVSVPQPAQTGWSQSFSTINNQSAKVPVWWAFMHALS
RAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFSRDCYGPARAKLFMQRPDLDEQQMHDVTW
IGSRFFTDTGGYYDSYRSSTAREAWPYDDTRDAGLAQVTNGGGYPTCKQWWSDGSNGLRARLLGQVDPSL
LNRLAGWAGFLSRAEVDDSVIRAIASPRQQKLNQGSVYTDYGGQIDKTLPNVVNRATSDVGLAVGALAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVVGTYDLKMVVTVSTVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVTGTMFLVLPTFWVAALGWVGVKAGVIAQNLAVGSKEAR
DSAGSGVNKVTGKVL
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|163854304|ref|NC_010170.1|:1554769-1556286 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGCTTTTCACGACCGACTACCTGGAGTACTACCTCACCCTCGTGTCCTGGATCGTCAACAACGGCA
TCTGGGCCGTGCTGGTGTCCAGCGGGGTGTTTGCGCTGCCCTTTGTGGCGATCGTCATCCAGGAATGGCT
CAAGGCCAGAGCGGAGGGCGCCGACGAAGGCAACAAGGGCGTGCTCTCGGCGGCGCGCATCGAGAACCGA
GTATTTGTGGCCATCGTGGTCGTGATGTTCGCCGGCATTCCGTTCATCGACGTCGACCTCAGCACTATCC
AGTACGACAGCTCGCGCTCGGCGCAGTGCCAGGTCAGCGTGCCACAGCCTGCGCAAACTGGCTGGTCGCA
GTCCTTCAGCACCATCAACAACCAGTCGGCGAAGGTTCCGGTCTGGTGGGCGTTCATGCACGCGCTTTCG
CGCGCCGTCACGAGCGCTTCGGTGGCTGCGATCCCGTGCGGCACAGATCTGAGGCAGATGCGTATGGAGA
TCGATGCGACCCGTATCGACGACCCGGTGCTGGCTCAGGAAGTGGCGGATTTCTCTCGGGACTGCTATGG
ACCGGCGCGCGCCAAGCTGTTCATGCAGCGCCCGGATCTCGATGAGCAGCAGATGCACGACGTGACCTGG
ATCGGCTCGCGCTTTTTCACGGACACAGGTGGCTACTACGACAGCTACCGCTCCAGTACGGCGCGAGAGG
CATGGCCCTATGACGACACCCGCGATGCTGGGCTCGCGCAGGTTACCAATGGTGGCGGCTACCCGACCTG
CAAGCAGTGGTGGTCCGACGGCAGTAACGGACTGCGCGCGCGGCTGCTGGGGCAAGTGGACCCGAGCCTG
CTGAATCGCCTGGCGGGCTGGGCTGGATTCCTGAGCCGGGCCGAGGTGGACGACTCCGTGATCCGCGCCA
TCGCGTCACCGCGGCAGCAGAAATTGAACCAAGGCAGCGTCTATACGGACTACGGCGGTCAGATCGACAA
GACGTTGCCCAATGTCGTCAACCGTGCCACCAGCGATGTTGGCTTGGCGGTTGGGGCTCTCGCCGCCTTC
CCGGCAATGGACGTAGTGCGCCAAGCACTGCCCATGGTGCTCGCGCTGCTCAAGATGGCGCTCGTGATCT
GCATTCCGCTAGTGCTGGTCGTTGGCACCTATGACCTGAAGATGGTCGTCACCGTCAGCACCGTCCAGTT
CGCGCTGTTCTTCACGGACTTCTGGTTTCAGCTCGCACGCTGGATCGACAGCACCATCCTCGATGCGCTC
TACGGGTGGGGCTTTGGCTGGAACCGGCCGCATACCAACTTCGACCCGCTGGTGGGGCTGAACAATGCCT
TCGGCGACATGCTTTTGATGTTCGTCACCGGCACGATGTTCTTGGTCCTGCCGACTTTCTGGGTGGCAGC
TCTTGGGTGGGTCGGAGTAAAAGCCGGGGTAATCGCTCAGAACCTGGCTGTCGGTTCCAAGGAAGCACGC
GATAGCGCGGGATCAGGCGTGAACAAGGTTACCGGCAAGGTGCTTTGA
 Primer design