SecReT4
Protein ID: 163856500
T4SS name [ID]Trb [349]
Gene symboltraF1
Locus tagBpet2189
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2269545..2270144 [+]
Productconjugal transfer protein TraF
Component typeTraF
UniProt IDA9IL24
KEGG IDbpt:Bpet2189
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.5e-53, Aligned region: 50..194
Protein Sequence: 199 a.a.     [Download]
>gi|163856500|ref|YP_001630798.1| traF1 gene product [Bordetella petrii DSM 12804]
MTTVSTTGTAPCPRSHARSRLRARIVLAGFAACGLAALAWASFVQPLPRLIYNPSDSVAVGWYRVDPLHH
RPGSLPRPSSVGSIVLTTLPPDAAALAAQRGYLPARVPLLKRVGATAPQHVCVFDALVWIDGVPVAAVRP
ADRLGRLLPSWPQCRQLRPGELFLLSVTNPASFDSRYFGPVSASAVIGVARPIWLEARP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2269545-2270144 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACCACCGTTTCCACCACCGGCACCGCACCGTGTCCTCGTTCGCATGCACGCTCACGCTTGCGCGCTC
GCATCGTGCTCGCTGGCTTCGCCGCCTGCGGCCTCGCTGCGCTGGCCTGGGCTTCGTTCGTGCAGCCGCT
GCCGCGCCTGATCTATAACCCGTCCGACAGCGTGGCCGTCGGCTGGTATCGCGTCGATCCGCTGCACCAT
CGGCCCGGCTCGCTGCCACGTCCGTCGTCCGTGGGCAGCATCGTCCTGACCACGCTGCCGCCAGACGCCG
CCGCGCTGGCCGCGCAGCGCGGCTACCTGCCGGCGCGCGTGCCGCTGCTCAAGCGCGTAGGTGCGACCGC
GCCGCAGCACGTTTGCGTTTTCGATGCGCTGGTGTGGATCGACGGCGTGCCGGTGGCCGCCGTCCGGCCC
GCCGACCGACTGGGCCGTCTGCTGCCATCCTGGCCGCAGTGCCGGCAGCTTCGGCCTGGCGAACTGTTCC
TTCTCAGTGTGACCAATCCGGCGTCGTTCGACAGCCGATATTTCGGGCCGGTCAGCGCATCCGCCGTGAT
CGGCGTCGCGCGCCCGATCTGGCTGGAGGCCCGCCCATGA
 Primer design