SecReT4
Protein ID: 163856517
T4SS name [ID]Trb [349]
Gene symboltraG1
Locus tagBpet2204
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2285138..2287141 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9IL69
KEGG IDbpt:Bpet2204
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-103, Aligned region: 111..558
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 3.7e-31, Aligned region: 172..541
Protein Sequence: 667 a.a.     [Download]
>gi|163856517|ref|YP_001630815.1| traG1 gene product [Bordetella petrii DSM 12804]
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDFLGTPIYHPWKLFEWWFFFDAYAPR
IFDIGGAIAGGSGLVAVVVAIGMSIWRSRQSRLVTTYGSARWANAEDIRKAGLTQPEGVFLGQHDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTPHLGDGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKATKLRYYADANFKRRVLPPPA
LADGQYADAPPLRPDDWSGLAIPAVPAAPAADAADGFGALADNGGPRRQPELSETVAYDPELAAPAADLA
LLDDDDDLPLPLPRQLDPAMQRTARLASLNPNDGIEL
 
Nucleotide Sequence: 2004 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2285138-2287141 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTGTTCGGCATCGTGATCGCCGGAGTGTGGG
GTGCCACGCAATGGACAGCAGCCGCCCTTGGCTATCAGTTACGCCTTGGCTCGCCCTGGTTCGATTTTCT
TGGCACGCCGATCTACCACCCGTGGAAGTTGTTCGAGTGGTGGTTCTTCTTCGACGCTTACGCGCCCCGC
ATCTTTGACATCGGCGGAGCCATCGCAGGCGGGAGCGGCTTGGTGGCGGTGGTGGTCGCCATCGGCATGT
CGATATGGCGCTCGCGCCAATCGCGCCTGGTCACGACCTACGGCTCCGCCCGCTGGGCGAACGCGGAGGA
CATTCGCAAGGCGGGCCTGACGCAGCCAGAGGGCGTGTTCCTCGGCCAGCACGATCGCCAGTACCTGCGC
CATGAAGGCCCGGAACATGTCCTGACCTTTGCGCCCACGCGCTCGGGCAAGGGCGTCGGCCTTGTTGTGC
CGACGCTGCTGTCCTGGCCCGCGTCCGCCGTCATCCACGACATCAAGGGTGAGAACTGGCAGATCACCGC
CGGCTGGCGCTCGCGCTTCTCGCACTGCCTGCTGTTCAACCCCACGGATGCGAAGTCGGCGGCCTACAAC
CCGCTGCTGGAGGTACGGCGCGGCGCGCATGAAGTGCGCGACGTGCAGAACATCGCGGACATTCTGGTCG
ATCCCGAAGGCGCGCTGGAGAAGCGCAACCATTGGGAAAAGACTTCGCACGCGCTGCTGGTCGGGGCCAT
CCTGCATGTGCTCTACGCGGGCGAAGACAAGACGCTGCGCGGCGTCGCCAACTTCCTCAGCGACCCGGCC
AGCCCGTTCGAGCTGACTTTGCATCGAATGATGACCACGCCGCACTTGGGCGACGGGCCGCATCCGGTAG
TCGCGTCGGCGGCGCGTGAAGTGCTCAACAAGTCGGACAACGAGCGTTCCGGCGTGTTGAGCACCGCCAT
GTCGTTCCTCGGCCTGTACCGCGATCCCACGGTGGCCGAAGTCACCTCGCGCTGTGACTGGCGCATCGCC
GACCTGATCGCGGCCGAGCATCCGGTGTCGCTGTACCTGGTGGTGCCGCCTTCGGACATATCGCGCACCA
AGCCGCTCATCCGCCTGATCCTCAACCAGATCGGGCGGCGGCTCACCGAATCGCTCGACGGCTCCGACGG
CATCGAACGCCGCCACAAGCTGCTGCTGATGCTCGACGAGTTTCCGGCCCTGGGCCGGCTCGACTTCTTC
GAGACAGCCTTGGCCTTCATGGCGGGCTACGGCATCCGTAGCTTCCTCATCGCGCAGTCGCTCAACCAGA
TCGACAAGGCGTATGGGCAGAACCATTCCATCCTCGACAACTGCCACGTCAGGGTGACGTTCGCCACCAA
CGACGAGCGCACCGCCAAGCGCATCTCCGAGACGCTGGGCACTGCGACCGAGCTGCGCGCCCAGCGCAAC
TACGCGGGCCATCGGCTCGCGCCGTGGCTGGGCCACCTCATGGTGTCGCGCCAGGAGACGGCCCGCCCGC
TGCTGACGCCGGGCGAAGTCATGCAGCTTCCGCCCGACGAGGCGGTGGTGATGGTGTCCAGCGTGGCACC
GATCAAAGCCACGAAGCTGCGCTACTACGCCGACGCCAATTTCAAGCGGCGAGTGCTGCCGCCGCCCGCG
CTGGCGGACGGGCAGTACGCCGACGCGCCGCCGCTGCGCCCCGACGACTGGAGCGGCTTGGCAATCCCTG
CCGTGCCCGCTGCGCCTGCGGCCGATGCAGCCGACGGCTTCGGGGCTTTGGCCGACAACGGCGGCCCACG
CCGTCAGCCTGAGCTCTCCGAAACCGTCGCCTACGACCCAGAACTGGCCGCGCCCGCAGCCGACCTCGCG
CTGCTCGATGACGACGACGACCTGCCGCTTCCCCTTCCTCGCCAGCTTGATCCAGCCATGCAACGCACGG
CCCGGCTGGCATCGCTGAACCCCAACGACGGAATCGAGCTATGA
 Primer design