SecReT4
Protein ID: 163856519
T4SS name [ID]Trb [349]
Gene symboltrbB1
Locus tagBpet2206
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2287599..2288681 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDA9IL75
KEGG IDbpt:Bpet2206
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.9e-81, Aligned region: 33..299
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 151..192
FtsK_SpoIIIE [PF01580], Evalue: 2.2e-06, Aligned region: 151..210
Protein Sequence: 360 a.a.     [Download]
>gi|163856519|ref|YP_001630817.1| trbB1 gene product [Bordetella petrii DSM 12804]
MSAVPRLPPEPRSSAAASLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLSSGRAPMGVEM
PEADGERIIRLVAAHVGAEVHSGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVVDG
MMTAAQAGFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTR
QGVVSMTELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRMEQLILEVAV
NPPRALIAEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLADWGADALETPFPELPLFPEAAPAAATS
PSSDQPGELP
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2287599-2288681 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAGCGCCGTTCCGCGACTCCCGCCCGAGCCACGCTCATCCGCTGCGGCTTCGCTCGACCGGCGCATCC
AGATGCTGCGCACGGCAATGGGGCCGCTGATCGCCACCGCGCTCGAAGACCCCGACGTGGTGGAAATCAT
GCTCAACCCGGATCGCACCCTTTGGGTGGATCGCCTGTCGTCGGGTCGCGCGCCTATGGGCGTGGAGATG
CCCGAGGCCGATGGCGAGCGAATCATCCGCCTGGTCGCCGCCCACGTCGGCGCGGAGGTGCATAGCGGTC
AGCCGCTGCTATCGGCTGAACTGCCCGAAACCGGCGAACGCTTCGAGGGCATCTTGCCACCCGCCGCACC
GGGGCCGGCCTTCGCGCTGCGCAAGCGCGCCATCGGCGTGATCCCGCTGGAGCGGTATGTCGTGGACGGA
ATGATGACCGCTGCCCAGGCGGGCTTTCTGGTGCGCGCCGTGCGCGAGCGTCAGAACGTCCTGATCGCCG
GGGCCACCAGCAGCGGCAAGACCACGCTCGCCAATGCCTTGCTCGCCGAAATCGCCGCCACCGGCGACCG
CGTGCTGGTGCTCGAAGACACGGTGGAGCTGCAATGCGCGGCCCGCGACCACGTGCCGCTGCGCACGCGG
CAAGGCGTCGTGTCGATGACCGAGCTGGTGCGCTCGTCCATGCGCCTGCGGCCTGATCGCGTCGTCGTCG
GCGAGGTGCGCGGTGCCGAGGCGCTGGATCTCATCAAGGTGTGGGGCACCGGCCATCCCGGCGGCATCGC
CACGATCCATGCGGGTTCCGCGCTGGGTGCGCTGTTGCGCATGGAGCAACTGATTCTCGAAGTGGCGGTG
AACCCGCCGCGTGCGCTGATCGCCGAGGCAGTCAACGTGGTGATCCACATCGCCGGTCGCGGGCGCAAGC
GCCGCATCGAGAGCATCGCCCGCGTCGTCGGCTTCGACGGTGTGGGCTACCGATTGGCGGATTGGGGGGC
GGACGCGTTGGAAACGCCGTTTCCCGAGCTGCCGCTATTTCCCGAAGCCGCACCCGCTGCGGCGACTTCC
CCGTCCTCTGACCAACCTGGAGAACTGCCATGA
 Primer design