SecReT4
Protein ID: 163856520
T4SS name [ID]Trb [349]
Gene symboltrbC1
Locus tagBpet2207
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2288678..2289070 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9IL78
KEGG IDbpt:Bpet2207
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-24, Aligned region: 28..120
Protein Sequence: 130 a.a.     [Download]
>gi|163856520|ref|YP_001630818.1| trbC1 gene product [Bordetella petrii DSM 12804]
MTQMIVPAFRVSANPALRLPIRSRLRSLARPAAQGLMLAALLLFLTGTAQAAGSSMPWEGPLQSILESIQ
GPVARIVAVIIIITTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 393 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2288678-2289070 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGCAGATGATCGTTCCTGCTTTCCGTGTTTCTGCAAATCCGGCTTTGCGCCTTCCCATCCGGTCGC
GGCTGCGCAGCCTGGCCCGCCCTGCGGCACAAGGGCTGATGCTGGCCGCGCTGCTGCTGTTCCTGACCGG
AACCGCGCAGGCCGCCGGTTCTTCAATGCCATGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAG
GGGCCGGTGGCGCGCATCGTCGCGGTCATCATCATCATCACCACGGGCCTCGCGCTGGCCTTCGGCGACA
CGTCGGGCGGATTCCGCAAGCTGATCCAGATCGTGTTCGGTCTGTCCATCGCGTTCGCGGCTTCGAGCTT
CTTCTTGTCGTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design