SecReT4
Protein ID: 163856521
T4SS name [ID]Trb [349]
Gene symboltrbD1
Locus tagBpet2208
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2289067..2289339 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDA9IL81
KEGG IDbpt:Bpet2208
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 6.2e-11, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|163856521|ref|YP_001630819.1| trbD1 gene product [Bordetella petrii DSM 12804]
MNAPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSLAVWGARV
DPQFMAVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2289067-2289339 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAATGCCCCGGATACCTTCGCGGCCGGCTTCGAGGTGCCGCTGCATCGCTCGCTGACCGAGCCGATTC
TGCTGGGCGGTGCGCCGCGTACCGTGGCAATCGCCAACGGCACGCTGGCCGCCGCTGTCGGGCTGGGCCT
GCAACTGTGGATTCCGGGCGTCGTGCTTTGGATCGTCGGCCATTCGCTGGCGGTCTGGGGTGCGCGCGTC
GATCCGCAGTTCATGGCCGTGTTCGCCCGGCACATCAAGCACCGCCCGCTGCTGGACGTGTGA
 Primer design