SecReT4
Protein ID: 163856522
T4SS name [ID]Trb [349]
Gene symboltrbE1
Locus tagBpet2209
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2289352..2291817 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9IL82
KEGG IDbpt:Bpet2209
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.5e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 2.9e-17, Aligned region: 299..388
DUF853 [PF05872], Evalue: 2e-07, Aligned region: 613..684
Protein Sequence: 821 a.a.     [Download]
>gi|163856522|ref|YP_001630820.1| trbE1 gene product [Bordetella petrii DSM 12804]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRAAADYPHSEFPEPLSWLVDEERRATFEESGNHFESGYHLTLVYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIAWLDDSQTLTYLHSTISTRRYRVGVPEVPFHIDAL
LTDSPLVGGLAPMLGDRHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCLDKSEAERELGRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDDDAGAADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSLPGNAYANVRQPIISTLNLAHMMPVSAVWAGPERNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGRSMRATILGLG
GEHYDLGMDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPDEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGMANVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPATLAFAGASTPQDQRAIDE
VLGRVPPGAGTPGFAGAWLRHRGLDWAADLLPSFPGLAPDSLADQPLENLP
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2289352-2291817 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCCAACGGCCCGCGCTGCTCGCCGACTGGCTGCCCTGGGCCGGGTTGG
TCGCGCCCGGTGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGACAGCGCCACGCAAGGCGAGCTGATCGCCACGTCGGCCCGCTTGAATAACGCGCTGCGCCGGCTGGGT
TCGGGCTGGGCGCTGTTCATCGAGGCCGAGCGCCGCGCCGCCGCCGATTACCCGCACTCGGAGTTTCCCG
AGCCGCTTTCGTGGCTGGTGGACGAAGAACGCCGGGCCACCTTCGAGGAATCGGGCAATCACTTCGAGAG
CGGCTATCACCTGACGCTGGTGTATCTGCCGCCCGAGGAATCGCGCGCCCGTGCCGCCAAGATGCTCTAC
GAGAACACGCCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGGG
TCTTTGACCTGCTCGATGGCGTCATGCCGGAAATCGCCTGGCTGGACGACAGCCAGACGCTGACCTATCT
GCACTCGACCATCTCGACACGACGCTATCGCGTCGGCGTTCCCGAGGTGCCGTTCCACATCGACGCGCTG
CTGACCGACTCGCCGCTGGTCGGTGGCCTGGCCCCCATGCTTGGCGACAGGCACCTGCGCGTGGTGTCGG
TACGCGGTTTCCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGATTTGGGTATCG
CTGGAGTACGCGCTTTCTGTGCCTCGACAAATCCGAGGCGGAACGGGAATTGGGGCGCCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCATCGCGCTGCTGCGCGAAACCATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCGAACAACAAGGCCGCCGATGCCGACGCCGCCTTGCAGGAGCTGGGCAGCGATCAAGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGACGACGCCGGCGCAGCCGACGAGAAGCTG
CGCATGGTGGAGCGGGTGATTCAGGGGCGTGGCTTCGTCACCATCCCCGAAACGCTCAATGCCGTGGATG
CGTGGCTGTCCTCGCTCCCCGGCAATGCCTATGCGAATGTCCGGCAGCCGATCATCTCGACCCTCAATCT
GGCGCACATGATGCCGGTGTCCGCCGTGTGGGCCGGCCCCGAGCGCAATGCCCACCTCGACGGCCCGCCG
CTAATCGTCACCCGCACCGATGGCGCGACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCCGGCCCGACTGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCGATGCAGTTTCGCCG
TTATCGCGGCTCGCGCATCTTCGCGTTCGACATGGGGCGCTCCATGCGCGCGACCATCCTCGGGCTGGGC
GGCGAGCACTACGACCTGGGCATGGATGGCGAAATCGCCTTTCAGCCCTTGGCTCGCATTGACCGCGAGG
GCTACCGCACCTGGGCCGCCGAATGGATCGAAGGCCGCTTGCTGCACGAAGGCGTGGCGGTCGGCCCCGA
CGAGAAGGCTGCTATCTGGTCGGCACTCGGCAGCCTTGCCGGTGCGCCGGTGGAGCAGCGCACGATGACC
GGGCTGTCCGTGCTGTTGCAGAGCAATGCGCTGCGCCAGGCGCTCGCGCCCTATGTGCTGGGCGGCGCGC
ACGGGAAGCTGCTGGACGCCGATCACGACCGGCTAGGCATGGCCAACGTGCAGTGCTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCGCGCTTTGACGAACGCTTC
GACGGTGCGCCCACGCTGTTGATCCTCGATGAAGCCTGGTTGTTTCTCGATGACCCGGTGTTCGCCGCGC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAAAACGTGTCGGTGATCTTCGCCACGCAGAGTCTTGC
CGACATCAAGGATTCGAGCATCGCGCCCGCGATCATCGAAAGCTGCGCGAGCCGCATCTTCCTGCCGAAC
CCACAGGCGACCGAACCGCAGATTCGCACGATCTACGAGGGCTTCGGGTTGAACTCGCGCCAGATCGAGA
TCGTCGCCACTGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGGCCGGCGACGCTGGCTTTTGCGGGCGCTTCCACGCCGCAAGACCAGCGCGCCATTGACGAA
GTTCTTGGCCGCGTGCCGCCGGGCGCCGGCACGCCCGGCTTCGCGGGCGCCTGGCTGCGCCATCGCGGCC
TCGATTGGGCGGCTGACCTGCTGCCCTCGTTCCCCGGCCTCGCGCCGGATTCCCTCGCTGACCAACCACT
GGAGAACTTGCCATGA
 Primer design