SecReT4
Protein ID: 163856523
T4SS name [ID]Trb [349]
Gene symboltrbJ1
Locus tagBpet2210
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2291814..2292539 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA9IL85
KEGG IDbpt:Bpet2210
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 6.3e-12, Aligned region: 2..36
Protein Sequence: 241 a.a.     [Download]
>gi|163856523|ref|YP_001630821.1| trbJ1 gene product [Bordetella petrii DSM 12804]
MKKRLVAAAIAAMLCTATAHAQWVVIDPTNLVQNTMTAIRTLEQINNQIRQLQNEAQMLMNQARNLASLP
SSVVGQLRANLATTERLIAQARGLAYDVTNLDREFARLYPEQYAATVSGDQMYRDTQERWKNTLNGLQTT
MQMQAQASQNLHDDEGVLADLVSKSQSAVGALQAMQATNQLLALQAKQSIQTQRLQITQDRAASLELARQ
AAATERAREVRRRFLGEGTPYTPQSVNFYRD
 
Nucleotide Sequence: 726 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2291814-2292539 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGAAGCGCCTTGTCGCCGCTGCCATCGCGGCCATGCTTTGCACCGCCACTGCCCATGCGCAATGGG
TCGTGATCGACCCCACCAACCTCGTGCAGAACACGATGACCGCGATCCGCACGCTGGAGCAGATCAACAA
CCAGATTCGCCAGCTCCAGAACGAAGCGCAAATGCTGATGAACCAGGCACGCAACCTCGCCAGCCTGCCG
TCCAGCGTGGTCGGCCAGTTGCGCGCCAACCTGGCGACGACCGAGCGGCTGATCGCCCAGGCGCGAGGCC
TGGCCTACGACGTGACGAATCTGGATCGGGAGTTTGCCCGCCTGTACCCGGAACAGTACGCCGCCACCGT
CAGCGGCGACCAGATGTATCGCGACACGCAGGAACGCTGGAAAAACACGCTCAACGGTTTGCAGACCACC
ATGCAGATGCAGGCGCAGGCATCGCAGAACCTCCATGACGATGAGGGTGTTCTGGCCGATCTGGTGAGCA
AGAGCCAGTCTGCCGTCGGTGCGCTGCAAGCCATGCAGGCCACGAATCAGCTTCTGGCCTTGCAGGCCAA
GCAGTCGATCCAGACACAGCGGCTCCAGATCACGCAGGACCGGGCCGCTTCGCTGGAACTGGCGCGGCAG
GCAGCGGCCACCGAGCGCGCCCGCGAAGTGCGGCGGCGCTTCCTCGGGGAAGGCACGCCGTACACGCCGC
AGTCCGTCAATTTTTACCGCGACTGA
 Primer design