SecReT4
Protein ID: 163856525
T4SS name [ID]Trb [349]
Gene symboltrbL1
Locus tagBpet2212
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2292832..2294202 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9IL91
KEGG IDbpt:Bpet2212
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-48, Aligned region: 37..264
Protein Sequence: 456 a.a.     [Download]
>gi|163856525|ref|YP_001630823.1| trbL1 gene product [Bordetella petrii DSM 12804]
MNDVTIIDQFLNTFATYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGDDVIAKLLRKVLY
VGAFAYILNNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAGAPILEQIGEMAGFPEVF
VNLDPIVVMFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVAAGIK
VLVLAVIVGIGSGLFSQFQVHPAEPNIDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAVGAAATGVSGAVAAGARMAPAAAKLAGSGGRAATSAAGSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQSAGRAAASRAAAAGQRMAAPFRAGWNGDAGASAGQAAASEAPAGAAAAQPADQPAWAKRL
QRRQQLTHAATTAAHTLRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2292832-2294202 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAGTTCCTCAACACCTTCGCCACCTACATCGACTCGGGTTTCGGGC
TGCTGCGCGGCGAAGTGGCGTTCCTCACAGCCACGCTGATCGTCATCGACATGACGATCGCCGGGCTGTA
TTGGGCCATGAGCCACGCCACCGGCCAGGGCGATGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCCTGAACAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTTGCGG
GATTGGGCATCACCGCCACCGGCTCGGCCATCACGATGGAGAACTTCCTGCAGCCGGGCCGGCTTGCCAA
GACCGGCATCGACGCCGGAGCGCCGATTCTGGAGCAGATCGGCGAGATGGCCGGTTTTCCCGAGGTGTTC
GTGAACCTCGACCCCATCGTGGTGATGTTCCTCGCATGGTTGGTCGTGGTGCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATTGAGTTCAAGCTGACCACGCTCGCCGGGTTCGTGTTAGTGCCGTT
CGCGCTGTGGAACAAGACCAGCTTTCTCGCCGAGAAGGTGCTGGGCAATGTGGTGGCCGCCGGCATCAAG
GTGCTGGTGCTGGCCGTGATCGTCGGCATCGGCTCGGGCTTGTTCTCGCAGTTCCAAGTCCATCCCGCCG
AGCCGAACATCGACCACGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTCGGGATCTTCGG
CCCTGGCATCGCCACGGGCCTCGTGTCCGGTGCGCCCCAACTGGGTGCGGGCGCGATGGCTGGTGCCGCC
GTCGGCGCAGCCGGAACGGCAGTGGCTGTCGGTGCTGCCGCGACGGGCGTGAGCGGTGCGGTGGCCGCTG
GTGCCCGCATGGCCCCGGCCGCCGCCAAGCTGGCCGGCAGCGGCGGGCGTGCCGCCACGTCGGCGGCTGG
CAGCGCGAAGTCGGCGTTCCAGGCCGGTTCCGCCGCCGCAGGCGGCGGCGCGAAGGGCGCTATGGCGGGC
CTGGGCAACGTCGCCAAGACCGGCGCGCAATCCGCCGGACGCGCTGCCGCATCCCGCGCTGCCGCTGCCG
GGCAGCGCATGGCCGCGCCGTTCCGCGCGGGCTGGAACGGAGACGCTGGCGCGTCAGCCGGCCAGGCCGC
CGCCAGCGAAGCCCCCGCAGGCGCTGCCGCTGCACAGCCCGCCGATCAGCCCGCTTGGGCCAAGCGGCTG
CAACGCCGCCAGCAACTCACCCACGCCGCGACCACTGCCGCCCACACGCTGCGCGGTGGCGACGGCGGCG
GCTCCGGCCAGGGGCCGAGCCTGCGCGATTCCGATTCATAA
 Primer design