SecReT4
Protein ID: 163856526
T4SS name [ID]Trb [349]
Gene symboltrbF1
Locus tagBpet2213
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2294215..2294919 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9IL93
KEGG IDbpt:Bpet2213
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.2e-62, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|163856526|ref|YP_001630824.1| trbF1 gene product [Bordetella petrii DSM 12804]
MRFKKPQVRYADTPPPATPYQAAGQVWDDRIGSARVQAKNWRFMAFGCFTLALLMAGGLVWRSAQSIVTP
YVVEVDNAGQVRAVGEAATPYRPNDAQTAHHIARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAAALND
YARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRYVNGAAAGLERWTAVVSIVLQPPRTEERLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2294215-2294919 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCGATTCAAGAAACCGCAGGTGCGCTATGCCGACACGCCGCCGCCTGCCACGCCGTACCAAGCTGCCG
GCCAGGTGTGGGACGACCGTATCGGCTCGGCCCGCGTCCAGGCCAAGAACTGGCGATTCATGGCCTTCGG
CTGCTTCACGCTCGCGCTGCTGATGGCCGGTGGTCTGGTGTGGCGCTCGGCGCAGTCCATCGTGACGCCC
TACGTCGTGGAGGTGGACAACGCGGGCCAAGTGCGCGCCGTGGGCGAAGCGGCCACGCCGTACCGCCCCA
ACGATGCGCAAACGGCGCACCACATCGCGCGCTTCGTGACGCTGGTGCGCTCGCTGTCCATTGACCCCAT
CGTCGTCCGCCAAAACTGGCTGGACGCCTACGACTACACGACCGACAAGGGCGCGGCCGCGCTCAACGAC
TACGCGCGGGTCAACGACCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTCG
TGCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAACGCCGCTACGTCAACGGCGCCGCGGCGGG
CCTGGAGCGGTGGACGGCCGTGGTGTCCATCGTGCTCCAGCCGCCGCGCACCGAAGAACGCCTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGTTTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCAAAGC
CATGA
 Primer design