SecReT4
Protein ID: 163856527
T4SS name [ID]Trb [349]
Gene symboltrbG1
Locus tagBpet2214
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2294916..2295908 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA9IL96
KEGG IDbpt:Bpet2214
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6e-67, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|163856527|ref|YP_001630825.1| trbG1 gene product [Bordetella petrii DSM 12804]
MNDLFRKSALPLIVLTLAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMPAQLMPVPEAE
DAKPTPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGNGADLRVNVLVKPIRSGLKTNLVITTSRRTYLLELTSTDKTWMASVSWEYPRDRM
LALQRQAQAASAAAPVDSGLSLENLRFRYAISGSNPQWKPLRAFDDGQKVYIQFPAGIAQGDLPPLFVIG
AEGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2294916-2295908 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCCTTGCCGTTGATCGTGCTCACCCTCGCGGGCTGCGCCACGCAGG
GCAAGCCGCCGCCGACCATCTCGCTCGATGAGCCGGTGCAGGCCCAGCCGCTGCCCGAGCCGCCCGCGCC
GGTGGAGGTGGTGGCCGTGCCCGAGGTGCTGCCGATGCCGGCGCAGTTGATGCCAGTTCCCGAGGCCGAG
GATGCCAAGCCCACACCCGAGCCGGCCGACGAGAAGGTGCGCGTTTCGCGGGCCAATGCCGAGGCGCGTG
TCGCGCCCACGCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCGTTCACCGATGGCGCGCTCTACCA
AGTCTATGCAGCCGTGGGCCGCGTGACCGTGGTTTCGCTCCAGCCGGGCGAGGAGCTGGTGACAGTGGCC
GCCGGCGATACCGTGCGCTGGATCGTGGGCGACACGTCTAGCGGCAACGGTGCCGATTTGCGCGTCAACG
TGCTGGTGAAGCCGATCCGCTCGGGCCTCAAGACCAATCTGGTCATCACCACCAGCCGCAGGACGTACTT
GCTGGAACTGACTTCCACGGACAAGACGTGGATGGCGTCCGTTTCGTGGGAGTACCCGCGCGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAAGCGGCCAGCGCCGCCGCGCCGGTCGATAGCGGCCTGTCGCTGGAGA
ACCTGCGCTTTCGCTACGCGATCAGCGGCAGCAATCCGCAGTGGAAGCCGCTGCGCGCCTTCGACGACGG
GCAGAAGGTCTATATCCAGTTTCCCGCTGGCATCGCGCAAGGCGACCTGCCGCCGCTGTTCGTGATCGGG
GCCGAAGGCGATGGGCAATTGGTGAACTACCGCTTCCGCTCGCCGTACTACATCGTGGATCGCCTCTTTG
GTGCGGCGGAACTGCGCCTGGGCGGCGACAAGGGCGACGTGGTGCGGATCGAGCGCACGGATGGCGTGGC
ACGGAGGAACTGA
 Primer design